Entry information : AtPrx46 ( At4g31760 / PER46 / AtperoxP46 / ATP48)
Entry ID 212
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-03-30 (Catherine Mathe)
Peroxidase information: AtPrx46 ( At4g31760 / PER46 / AtperoxP46 / ATP48)
Name (synonym) AtPrx46 ( At4g31760 / PER46 / AtperoxP46 / ATP48)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Micropylar endosperm
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx46
start..stop
S start..stop
AhalPrx48 589 0 1..326 1..326
AlyPrx46 580 0 1..326 1..326
TsPrx46 576 0 3..326 6..330
BstrPrx22 575 0 1..326 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15369503..15369724 222 N° 2 15369243..15369422 180 N° 3 15368848..15369013 166 N° 4 15368260..15368672 413
complement(join(15368260..15368672,15368848..15369013,15369243..15369422,1536950 3..15369724))


exon

Literature and cross-references AtPrx46 ( At4g31760 / PER46 / AtperoxP46 / ATP48)
Protein ref. UniProtKB:   O81772
DNA ref. Phytozome 12:   Chr4 (15369724..15368260)
mRNA ref. GenBank:   NM_119325
Cluster/Prediction ref. Phytozome Gene 12:   19644045
Omic ref. AtProteome:   At4g31760 ATTED-II:   At4g31760 e-FP Browser:   At4g31760 ePlant:   At4g31760 Genevestigator:   At4g31760 TAIR:   At4g31760
Protein sequence: AtPrx46 ( At4g31760 / PER46 / AtperoxP46 / ATP48)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   35107.96 (32167.5) Transmb domain:   %s   i12-34o
PI (pH):   %s   4.49 (4.39) Peptide Signal:   %s   cut: 28 range:28-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSYRINCSTLLHLLMFLSSLLTSSANLSFNFYASSCSVAEFLVRNTVRSATSSDPTIPGKLLRLFFHDCFVQGCDASVLIQGNSTEKSDPGNASLGGFSVIDTAKNAIENLCPATVSCADIVALAARDAVEAAGGPVVEIPTGRRDGKESMAANVRPNIIDTDFTLDQMIDAFSSKGLSIQDLVVLSGAHTIGASHCNAFNGRFQRDSKGNFEVIDASLDNSYAETLMNKCSSSESSSLTVSNDPETSAVFDNQYYRNLETHKGLFQTDSALMEDNRTRTMVEELASDEESFFQRWSESFVKLSMVGVRVGEDGEIRRSCSSVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). no EST. Addition exon in T-term in Phytozome and TAIR
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTTGGTGT CAATAAAGTG AGAATCAGTC ATTTGTGTGA GTAGGACACT TTGAGCGGCC ACCATATAAC GAGAGCACCA TCAGATCGGT CTATCATGTT CGTGACTATG ATGTCCAGAA  GTTGATGCAA CTTGAAGAGC CGCTTGATAT ATTTCTATCA CATGATTGGC CTGTTGGAAT CACTGATTAT GGAGACTCAG AATCACTTAT GCGGCAAAAA CCATACTTTC GTCAAGAGGT  AAATCTGTGG GAACATGATT CTACTTCTTC ATTTTGGTTT TGAGAGGTTT TCAATTGATT TGACCAAAAT TTATTACAGA TCGAGGAAAA AACTCTTGGA AGTAAACCAG CGGCTCTACT  GCTAGAAAAA CTGAAGCCTC AATATTGGTT TTCAGCTCAT TTACATTGCA AATTTGCTGC TGCTGTTCAA CACGGGAATG ATGGGTCAGT GACAAAATTT CTTGCCCTCG ATAAATGCCT  TCCAGGGAAA AAGTTTTTAC AGGTTCTCTT TCTTTCCTGT CCACAACATT ATGCTTTGTT CTTTTGAAAC AAAAAGGATA TCTTTTAATT TCTTTGGATG TTCATTAGAT TATTGAAATC  GAATCAGAGC CTGGACCCTT TGAGGTCCTA TACGATGAAG AGTGGCTAGC AATCACACGA AAGTTCAATT CTATTTTCCC GCTAACAAGG AGATACACAA ACGTCAGGTA TACCATCCCG  AACAAGCTAC CTACTAAGAA ATGTTTATAT ATCTTCCATT TATCTTTCTA CCTACCGTCC CACTTACGTA TTGTTTTACT ACAATAGCAC TGCTGGAACT ATACAAGAGA GCCGTGAGTG  GGTGAGGAAG AAGCTAGAAG AAAGGCAATT TAAACCTTTT GAGTTTGCGA GAACAGTACC TGCATATAAC CCATCACAAC GTGTATTTGA TTCCATTCCT GGTATGTTAA TAGTGTACTG  GATATAGAGG ATTATAAAAA GTTGATGGAT CGATTAAAAG TGTTTTATTC ATATGGCATT TTGTAGAGAT CCCGCAGAAT CCCCAGACGC TGTCTTTGTT AGAGCTCCTT GGTCTCCCAT  ATCTCCTTGA TTCATCACCA GTAACAGGGG AAAGAACCGA TATCCCTGCT TCACTGGCTC CATCAGGTAT GACGATAGTT TTCTTTGTAG ATGAGGACTT GGTTTGGGAT TATCAGATAC  ATATTCTGTG AAGTTGTTCA TTTACTCTTT CTATCTGCCT ATTGTCATGA AACTGCATCA AGCACCAATG ACAGAGATGT TTAGTGCAGT GTCAAGAATC AAACATGTCT TGTTGTGTAT  TGCAGATCTT CCGACATATG ATAGCGAAGA AATCCCAATT GATGACATTG ATGAAATAGA AGAGATGGAG GAAGCAAAAG CAGATGATCA TACAAGAGAC GATGCATGAA TATCTCCATT  CCAGTGGTCA GAATATATTT TATCTTGCTA ATATCTGACT GCTTCATCGT CAAGCTGGAA AACAACCACA TTAGTTGGGA TTCTGTGATT AGAAAACCAA GTTTTCTTGT TCATTTTTTA  GAATCAGCAT AAGTTTTATT TGTGATATTA AAGAAAAGTG AATCATAAAA ATGTCTTGGA GAAATAAAAA GTTAGATATT AATGTTTCAT CCAGTATTCA AGAAAGTTGA TCACCTTTTC  TTCCACAAGT TCTCTGGCAT GCATTGGCTT GGGAAGTTAC TCGCCGACAA AACCCATAGA TAAGTATGTC GGATTCACTT AAAACCATGG ATGATGCTGG GAATGTTGGA TTCAACTAAA  CACGACCATC AATGATTCTT CATTGAATGC GTTGACTCAA CTTCATCACC TCAACTAATT TTCTATCTCT GACACTAACA TCAAATGCAA ATTATGAAGT GAACAGTTGC AGTTTATTAC 
AACAACCTTC AAGATTCCTC TCATTCTCCT TTCTATTTTC ATTGTCACTT TATTCGAGTC AAAACACAGA GACAATAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACAGAGGAG GACGTGAGAT AAATCAAGCG TAGAACAATC AGCTGCATGT GACAGCCACG TGTCGAAATC TAGTGAGAAG GACGGTTGAT TCATTCTAAC TTGGGTTCAC CGTAAAGTTG  ACAAACCCAA AAAAAAAAGA AAAAAGGAAG GAATAATAAT CATCTTTTTA GGCCCACGAG ATTGCTCTTT GCTTATAGAG ATAACATCAA ATATATTTAT TTCTCAAATT ACCAACTACT  TATCCGTAAT TAAATCATTA TTATTAATTG CTAATAATGA AAACATATAA TTGTATCCAT AATTAATTGG GTATCATATT TCAAAAAGTT AGCTGGTTCT TCGTCATAAA TTTCTCCAGT  TTTGTCAAAA ACGAAGACCA CAGCGAGCCC TAAATCTTGT CGGGCGTTGA ATCTTACAAA TTTGCAAGTG ATTCTCGTCA TACCTGTATC TTCTTCTTCT TCTTCGTTCT TCTTCTGGTA  CGCCCAAATT ACTCTCAAAT CTCCCCCAAA TTACTCTTAT TTTTCGATCT GATCGTGCTC AATCCATTGC CATTTCAATT TGTTTGCTCA ATCCATTGGC TATTTCCAAT TATCTGCTCA  TTATTTGTGC TGTGGATAGT CGTTCTGGCT TCAGGACTCG GTCTCGTCAT TGGTTTGATA TGTCTGTTGA GCATTTGGTG ATTATTGACA TATTGTTTTA CATGTTTTTC GACGTTGTGT  TAGGATTTGA TTGGTGGACA AAGGTAGCTG AATCAGCTTC AGAATTGAAT TTGATCTTTG TTTGAGACAA GAAGCATTGG TGTTTGGAGC ATTTCTGAGG AGTTATGGGA TATCTGAATT  CTGTTTTGTC ATCTTCGAGC CAGGTTCACT CCGACGATGG ACCTGTTAGC GGTGGTGGCC TCAGGTTCAC TTTTCTCTTT CTCCCCAGCT TAATCTTTCT CAGGTTTTTA GTATTAAGTT 
ATAGGATTAA GAATGCAACT ACAGATTATA GATTGCTCAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCTCTTACAGAATAAACTGTTCCACTCTTCTTCATCTCCTTATGTTTCTGTCTAGTCTTCTCACTTCCTCCGCCAACCTCTCCTTTAATTTCTATGCTAGTTCTTGTTCTGTA
GCCGAGTTTCTAGTCAGAAACACCGTTAGATCAGCTACCTCCTCCGATCCAACGATCCCCGGGAAACTCCTTCGTCTTTTCTTCCACGACTGTTTCGTCCAG
GTAACACGCACTAATTAC
GAATTACTGAGGAAAGTTCAAACAATTTGGCTTAAACTTTGTTTGTTGGTTGAACTTGCAAGGGTTGTGATGCATCAGTGTTGATACAAGGGAATAGCACAGAGAAAAGCGATCCCGGAA
ACGCATCTCTTGGAGGATTCTCAGTCATAGACACAGCCAAGAATGCCATCGAGAATTTATGTCCGGCCACTGTTTCTTGCGCTGACATAGTTGCACTTGCTGCTAGAGACGCCGTCGAAG
CT
GTAACATTTACTTCACTCCCACTTCACTTCAATCTATATTGCTCTAATCCGGTTTAACCAATCCCAACTGAACCGAAAGCATACACATGAAATCGAAAAAAAGAAACAAACCAATTCT
GTATCATTTTCGCATAGACTACACAATGAACCAAATATAACCGGAGTTGTAGATACATTAAACCGGTTATCCTTATTAAGGTTTGAATGTTTTTCTTCTTTGGCGGGACAGGCAGGAGGA
CCGGTGGTTGAGATTCCGACAGGGAGGAGAGACGGGAAAGAATCGATGGCTGCAAACGTGAGACCGAACATCATCGACACAGATTTTACTCTCGATCAAATGATCGATGCCTTCTCTTCC
AAAGGCTTGTCCATTCAAGATCTCGTCGTCCTCTCAG
GTATATATCAACGTTTCTTGAAACTTCTAATCAATTTTACCAACATGTTTTGCTAAACGCAAACAGAGTATGAAACAGAGTTT
TTTTTCTTTAACTATGGTAAAGTCAATTCTTGTAGCAAAATCTGTTTCATATTCTGTTACACTCAGCTTCTTCTTTTTTTATTTACATTCAGGAGCACACACAATTGGAGCATCACACTG
TAACGCATTCAATGGAAGGTTTCAACGAGACTCGAAAGGAAACTTCGAGGTAATTGATGCGTCTCTCGACAACTCCTACGCAGAGACACTAATGAACAAGTGTTCGTCCTCGGAATCCTC
ATCATTGACTGTGAGCAACGATCCAGAGACATCTGCCGTATTCGATAATCAGTACTATAGGAATCTTGAGACGCACAAGGGTTTGTTTCAGACGGATTCTGCTTTGATGGAGGATAATCG
GACGAGGACAATGGTGGAGGAATTAGCGAGTGATGAGGAAAGCTTTTTTCAAAGATGGAGTGAGTCGTTTGTGAAACTGAGTATGGTTGGTGTGAGAGTTGGTGAAGATGGTGAGATAAG
ACGTTCTTGTTCTTCCGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCTCTTACAGAATAAACTGTTCCACTCTTCTTCATCTCCTTATGTTTCTGTCTAGTCTTCTCACTTCCTCCGCCAACCTCTCCTTTAATTTCTATGCTAGTTCTTGTTCTGTA
GCCGAGTTTCTAGTCAGAAACACCGTTAGATCAGCTACCTCCTCCGATCCAACGATCCCCGGGAAACTCCTTCGTCTTTTCTTCCACGACTGTTTCGTCCAG
GGTTGTGATGCATCAGTG
TTGATACAAGGGAATAGCACAGAGAAAAGCGATCCCGGAAACGCATCTCTTGGAGGATTCTCAGTCATAGACACAGCCAAGAATGCCATCGAGAATTTATGTCCGGCCACTGTTTCTTGC
GCTGACATAGTTGCACTTGCTGCTAGAGACGCCGTCGAAGCT
GCAGGAGGACCGGTGGTTGAGATTCCGACAGGGAGGAGAGACGGGAAAGAATCGATGGCTGCAAACGTGAGACCGAAC
ATCATCGACACAGATTTTACTCTCGATCAAATGATCGATGCCTTCTCTTCCAAAGGCTTGTCCATTCAAGATCTCGTCGTCCTCTCAG
GAGCACACACAATTGGAGCATCACACTGTAAC
GCATTCAATGGAAGGTTTCAACGAGACTCGAAAGGAAACTTCGAGGTAATTGATGCGTCTCTCGACAACTCCTACGCAGAGACACTAATGAACAAGTGTTCGTCCTCGGAATCCTCATCA
TTGACTGTGAGCAACGATCCAGAGACATCTGCCGTATTCGATAATCAGTACTATAGGAATCTTGAGACGCACAAGGGTTTGTTTCAGACGGATTCTGCTTTGATGGAGGATAATCGGACG
AGGACAATGGTGGAGGAATTAGCGAGTGATGAGGAAAGCTTTTTTCAAAGATGGAGTGAGTCGTTTGTGAAACTGAGTATGGTTGGTGTGAGAGTTGGTGAAGATGGTGAGATAAGACGT
TCTTGTTCTTCCGTCAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCT CTTACAGAAT AAACTGTTCC ACTCTTCTTC ATCTCCTTAT GTTTCTGTCT AGTCTTCTCA CTTCCTCCGC CAACCTCTCC TTTAATTTCT ATGCTAGTTC TTGTTCTGTA  GCCGAGTTTC TAGTCAGAAA CACCGTTAGA TCAGCTACCT CCTCCGATCC AACGATCCCC GGGAAACTCC TTCGTCTTTT CTTCCACGAC TGTTTCGTCC AGGGTTGTGA TGCATCAGTG  TTGATACAAG GGAATAGCAC AGAGAAAAGC GATCCCGGAA ACGCATCTCT TGGAGGATTC TCAGTCATAG ACACAGCCAA GAATGCCATC GAGAATTTAT GTCCGGCCAC TGTTTCTTGC  GCTGACATAG TTGCACTTGC TGCTAGAGAC GCCGTCGAAG CTGCAGGAGG ACCGGTGGTT GAGATTCCGA CAGGGAGGAG AGACGGGAAA GAATCGATGG CTGCAAACGT GAGACCGAAC  ATCATCGACA CAGATTTTAC TCTCGATCAA ATGATCGATG CCTTCTCTTC CAAAGGCTTG TCCATTCAAG ATCTCGTCGT CCTCTCAGGA GCACACACAA TTGGAGCATC ACACTGTAAC  GCATTCAATG GAAGGTTTCA ACGAGACTCG AAAGGAAACT TCGAGGTAAT TGATGCGTCT CTCGACAACT CCTACGCAGA GACACTAATG AACAAGTGTT CGTCCTCGGA ATCCTCATCA  TTGACTGTGA GCAACGATCC AGAGACATCT GCCGTATTCG ATAATCAGTA CTATAGGAAT CTTGAGACGC ACAAGGGTTT GTTTCAGACG GATTCTGCTT TGATGGAGGA TAATCGGACG  AGGACAATGG TGGAGGAATT AGCGAGTGAT GAGGAAAGCT TTTTTCAAAG ATGGAGTGAG TCGTTTGTGA AACTGAGTAT GGTTGGTGTG AGAGTTGGTG AAGATGGTGA GATAAGACGT 
TCTTGTTCTT CCGTCAATTA A 

Retrieve as FASTA