Entry information : AtPrx49 (At4g36430 / PER49 / AtperoxP49 / ATP31)
Entry ID 215
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: AtPrx49 (At4g36430 / PER49 / AtperoxP49 / ATP31)
Name (synonym) AtPrx49 (At4g36430 / PER49 / AtperoxP49 / ATP31)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Green siliques
Mixed tissues
Roots
Inducer Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx49
start..stop
S start..stop
AalpPrx09 650 0 1..331 1..331
AhalPrx32 629 0 1..331 1..331
AruPrx49-1 625 0 1..331 1..331
AruPrx49-2 625 0 1..331 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17205693..17205917 225 N° 2 17205421..17205612 192 N° 3 17205179..17205344 166 N° 4 17204648..17205060 413
complement(join(17204648..17205060,17205179..17205344,17205421..17205612,1720569 3..17205917))


exon

Literature and cross-references AtPrx49 (At4g36430 / PER49 / AtperoxP49 / ATP31)
Protein ref. UniProtKB:   O23237
DNA ref. Phytozome 12:   Chr4 (17205917..17204648)
mRNA ref. GenBank:   NM_119806
Cluster/Prediction ref. Phytozome Gene 12:   19648806 UniGene:   At.4607
Omic ref. AtProteome:   At4g36430 ATTED-II:   At4g36430 e-FP Browser:   At4g36430 ePlant:   At4g36430 Genevestigator:   At4g36430 TAIR:   At4g36430
Protein sequence: AtPrx49 (At4g36430 / PER49 / AtperoxP49 / ATP31)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   36054.14 (33603.8)  
PI (pH):   %s   8.48 (8.56) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLTSFLLLLSLICFVPLCLCDKSYGGKLFPGYYAHSCPQVNEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCDGSLLLDSSGRVATEKNSNPNSKSARGFDVVDQIKAELEKQCPGTVSCADVLTLAARDSSVLTGGPSWVVPLGRRDSRSASLSQSNNNIPAPNNTFQTILSKFNRQGLDITDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDMTLEQSFAANLRQRCPKSGGDQILSVLDIISAASFDNSYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 6 cDNA and 6 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCCCTTGAG CTAAATATTT CCATTGCTTG ATATCATTTC AGAATACAAT CAAGGTAACG AAGGAGGATC AGCGAAAGGA TGGGCTATAT TTGGAGTTTT TTCCTGCGTG TAAGTAATGC  TTTGTGATCT TCCATGCGGA CATATAACTG AAGAATAAAC TCAACTCATT GTGTTCTGGT GTGTTTCTTC TGATCAGATT CCTCGTTGCA TCTGCACTTT TCTGCTGTGG GGGCTTTATT  TATAAAACAA GAGTAGAGCG TGTGGTAATC TTCATATCTT TCTACAATTC CACTTCCATT CTCTAATTAT TCTCTCACGT GATATACACA CACTCAATCA CTGATGTACT CGTATGGATG  CAGCGTGGAA CTGATGCATT GCCGGGGATG TCACTTCTAT CGGGCTTACT AGAAACTGTA AGTATTACAA GAAAACTCAA AAGGATTCCA TTTATGCAAA ATCTAAGAGA AAGCTCACTG  TGGTCTTTGG TTACAATTTA TGGATCTCTC AAGAGACAAA TGCTATGTAA GCTAATTGAT TTTGGTCTTG ATAAACAGGT GAGTGGAAGT GGACAAAGCT ACTCAAGAAC TGAAGACATC  AACAATGCTT TTGCCAATGA AGTCTCATGG GACCGCTCTT CCGCATCTTC TACTCAAGCG ACAACAACAC AGAGACCAAG TGAAAGAACA TATGGTGCGA TCTAATTTTG TCAAGTGCCT  CACAAGAGGT ACTGTTTCAA GCCATGGTAT GGCACGCTTG TGATCTGCGA TTTCTGGATT TTGCTTTGTA TGTTTATTTT CTACCTTCTA GAAAGAGGTC AAAAAGTTAA TAGCTTCACC  GTGAGAATGT TGTTTTCACC AGATTCATGT GCTATGATAG AAAAAGACAA AGCAAACAAG AGTTCTTTCT TTGCTTAGGT TACAAGAACA AGAGTATCGT TATAAAGTCA ACAAAGATTG  AAACATATTT TTGTCAAGGG AGTGGTTAGA ATCTCTTCCT ACTCTCTTGC CTTTCTCACT AAGACAAAAA AAAGACTTGG ACTTTGTCTA AGGTTTTGTG GATATTATTA ACCAAGTCCT  TTTGCAAAAA GTAATATTGT TTTTTCGCAT TCCTCTTTTA GAATTTAGTT TAATCTAGGC TTTATATTGG TTATTACTTT CTTGAAAAAT GATCTGTTTA TTCTATTCAT ACTTGGTTAC  CTCGCTTTTT ATCTTACTTC TACAAAAGGA TTATCAGTGA AAGTTAGTCT CTTACTCTCA CCTTCCGAAA ATAAAACAAA AATATCGATA CTTCTAGATC AAACCAAGTT GATTAAAACA  TCCCTATTCC CTACGATTCT GATCTTGAGA TATATTATCA TGTTAAGATC TAAATTGACA AGAAAACTGA TTTTTCATTT CTAGTAGGAA AAATAATTAC TATTAGTGAT CATGATTGTC  GACCGTAAGA GGTGGTTTAG TTACTCTCCA TCTTTCTTTG AAGAAGTCAG AAAGTCAGAA ATTATATCAA ATTAAACATC AATATTGAAC ACATATATCT GTATGGTTTT ATGTTTAGAA  AATTCCAATA TTTATATATT CCTAGGGAAA AAGAAGCTTA TTCTTCAAAT TATTGTTATG AGTCGTTAAA ATATGGATAA AAATATAAAG TCTAAATATT AAAAACTCAG TTTGCTTTGC  TTTTACCTCT CCAAGTCTCC AAAGTCAAAT TAATTTTAGT TAATTAAACC AAAAAAGGTT TATTAGTCAA ACTTAGCATG CAATGCTGGG TACCAAACCC AAGCATTAGT CTCTTTTAAT  CTTCTTTTTC TCCAATAAGT TTTTACAATT TTTAATTGTT TGCATTTCCC TTGATTATTT ATCTTCATCC CAATTTAGCT AATACCAACT CCGTTTCTTA TTCTTCCAAG TCTTTTCCTA 
TAAATACGTT CTTCTTCCCC TCTTATTTCA TATCACTCAC CACAAAGTCT TCTCATTTCC TCATCTTCTT GTTGAAAGTA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGAAACAAG AAAACTCTTC TTATATCTTG TGGAACAAAT GTGAGACATT TACTTTTACT TTGGAGTGTG TTTTGTTTGT TTTTTTCAAT TCTGTCATTT GGAAGTTTTA TTTCGTGTTA  TTTGCGTTGT GTTAAGACAT AAGTTTGAAA TTTATAAAAC TTGTACGAGG AAATATTTTG AAATTATAAA CTTTAAACTA TTATTGGGCC TAACCGAACC TAATAATTTA TGAATTCAGA  AAACACTAAA TCTTAAAACT GATAGGCCCA TAAAGGCCCA TTTCACATCC CACTAGTTAG GGTTTATGCT TTCTTCTCAC ATTTCAGCTT CAGATGCACT GACATGAATT CTCAACGAAG  CTAAGATCAA TTCGATAGAG AGTGAAAACT ATGAGGAATC TGCGAATCAT CTCCTCTCAC TTCTCACGAG TTTTGAAATC CACCGAGACA CGCTCAAGTT CCGTTCAATT ATTCACGATC  CAATCTCGGA GCTACTCATC TCCGGCGACG CAATCGGAGA ACGTGTCCAA AATCGTCAAT GAGCTATCGA ATCTCACTCT TTTGGAAACA ATGGATCTTA CTGAGATCCT TAGGCAGAAG  CTAAACATCA GTGAATTGCC TGTGATGGCG GCGATGATGC CAGGGATGTC ATTACCGGGA TCTGGAGCTA GTAAATCCGC CGGCGGAGAA GGGAAAGAGA AGAAGAAGGA AGCAAAGACT  GCGTTTGATG TGATGCTTCA AGCGTACGAT GCAGTGTCGA AGATAAAGGT GATTAAAGAA GTGAGAACGA TTACGGCATT GGGGTTGAAG GAAGCGAAAG ATTTGGTGGA GAAAGCTCCA  ACATTGTTGA AGAAAGGAGT TAGTAAGGAA GAAGCAGAGA AGATCATTGA GAAGTTGAAG GCTGTTGGAG CTAAAGTTGC TATGGAGTGA CCATTTTTAG GTACCTCTAT ACTTTCGATT 
GCTCCTAAGC AGATGGATTA GCTAGCTTTA GTTTGTTTGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCACGAGCTTTCTCCTTCTTCTTTCTCTCATCTGCTTTGTCCCTCTCTGTCTCTGCGACAAGAGCTATGGAGGCAAACTTTTCCCGGGTTATTACGCCCATTCATGCCCA
CAAGTCAATGAGATCGTGAGATCAGTTGTAGCTAAAGCTGTTGCTAGAGAGACACGTATGGCTGCTTCCTTGTTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GTTTAGTTAATTTCT
TTTACGTTTCAACATTTTATGTTGTTTTAAGTTTACTTGCTAAACAAGGTAACTGTGAAATGTAGGGTTGTGATGGCTCTTTGCTTCTAGACAGCAGTGGAAGGGTAGCGACTGAGAAAA
ACTCAAACCCTAACAGCAAATCAGCTCGTGGGTTTGACGTAGTTGACCAAATCAAAGCTGAACTGGAGAAACAATGCCCTGGAACTGTTTCTTGCGCTGATGTTCTTACCCTAGCCGCTA
GAGACTCCTCTGTTCTT
GTAAGTTTCCTCCACAATCTCTATTTTCTCGAACCAAAACTGAAACATCAGCTAACTCGGTTGGTTTTTGGTTTAGACCGGTGGACCAAGTTGGGTTGTTCCA
TTGGGAAGAAGAGATTCAAGAAGTGCAAGCTTGAGTCAATCGAACAACAACATCCCTGCACCAAACAACACTTTCCAGACCATTCTATCTAAGTTTAACCGTCAAGGACTTGATATCACT
GACCTTGTCGCTCTCTCCG
GTAAGCTTTCGTCACTCTATCACAGTTTCTTGCTTCACACACATGGAACACAATTAAAAAAAATCCATTATACATTACTTGCTTCTCAAGCCACCACACTT
CTCAAATGTTATCTCAGGTAGTCACACAATCGGATTCTCGAGATGCACGAGTTTCAGACAGAGGTTGTACAACCAGTCCGGAAACGGCAGTCCAGACATGACATTGGAACAATCCTTCGC
TGCTAACTTGCGCCAACGGTGTCCAAAATCCGGTGGGGACCAGATTCTCTCGGTGCTAGACATCATCAGCGCCGCGAGCTTCGACAACAGCTACTTCAAGAACTTGATAGAGAACAAGGG
GTTGTTGAACTCGGACCAAGTTCTGTTCAGCAGTAACGAGAAATCGAGAGAGCTTGTGAAGAAGTATGCAGAAGATCAAGGAGAGTTTTTTGAGCAATTTGCGGAATCGATGATCAAGAT
GGGAAATATCTCTCCCTTGACAGGTTCTAGTGGCGAAATCAGGAAGAATTGCAGGAAGATTAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCACGAGCTTTCTCCTTCTTCTTTCTCTCATCTGCTTTGTCCCTCTCTGTCTCTGCGACAAGAGCTATGGAGGCAAACTTTTCCCGGGTTATTACGCCCATTCATGCCCA
CAAGTCAATGAGATCGTGAGATCAGTTGTAGCTAAAGCTGTTGCTAGAGAGACACGTATGGCTGCTTCCTTGTTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GGTTGTGATGGCTCT
TTGCTTCTAGACAGCAGTGGAAGGGTAGCGACTGAGAAAAACTCAAACCCTAACAGCAAATCAGCTCGTGGGTTTGACGTAGTTGACCAAATCAAAGCTGAACTGGAGAAACAATGCCCT
GGAACTGTTTCTTGCGCTGATGTTCTTACCCTAGCCGCTAGAGACTCCTCTGTTCTT
ACCGGTGGACCAAGTTGGGTTGTTCCATTGGGAAGAAGAGATTCAAGAAGTGCAAGCTTGAGT
CAATCGAACAACAACATCCCTGCACCAAACAACACTTTCCAGACCATTCTATCTAAGTTTAACCGTCAAGGACTTGATATCACTGACCTTGTCGCTCTCTCCG
GTAGTCACACAATCGGA
TTCTCGAGATGCACGAGTTTCAGACAGAGGTTGTACAACCAGTCCGGAAACGGCAGTCCAGACATGACATTGGAACAATCCTTCGCTGCTAACTTGCGCCAACGGTGTCCAAAATCCGGT
GGGGACCAGATTCTCTCGGTGCTAGACATCATCAGCGCCGCGAGCTTCGACAACAGCTACTTCAAGAACTTGATAGAGAACAAGGGGTTGTTGAACTCGGACCAAGTTCTGTTCAGCAGT
AACGAGAAATCGAGAGAGCTTGTGAAGAAGTATGCAGAAGATCAAGGAGAGTTTTTTGAGCAATTTGCGGAATCGATGATCAAGATGGGAAATATCTCTCCCTTGACAGGTTCTAGTGGC
GAAATCAGGAAGAATTGCAGGAAGATTAACTCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCACTCACC ACAAAGTCTT CTCATTTCCT CATCTTCTTG TTGAAAGTAA TGGCAAGACT CACGAGCTTT CTCCTTCTTC TTTCTCTCAT CTGCTTTGTC CCTCTCTGTC TCTGCGACAA  GAGCTATGGA GGCAAACTTT TCCCGGGTTA TTACGCCCAT TCATGCCCAC AAGTCAATGA GATCGTGAGA TCAGTTGTAG CTAAAGCTGT TGCTAGAGAG ACACGTATGG CTGCTTCCTT  GTTGAGACTT CATTTCCACG ACTGTTTCGT TCAGGGTTGT GATGGCTCTT TGCTTCTAGA CAGCAGTGGA AGGGTAGCGA CTGAGAAAAA CTCAAACCCT AACAGCAAAT CAGCTCGTGG  GTTTGACGTA GTTGACCAAA TCAAAGCTGA ACTGGAGAAA CAATGCCCTG GAACTGTTTC TTGCGCTGAT GTTCTTACCC TAGCCGCTAG AGACTCCTCT GTTCTTACCG GTGGACCAAG  TTGGGTTGTT CCATTGGGAA GAAGAGATTC AAGAAGTGCA AGCTTGAGTC AATCGAACAA CAACATCCCT GCACCAAACA ACACTTTCCA GACCATTCTA TCTAAGTTTA ACCGTCAAGG  ACTTGATATC ACTGACCTTG TCGCTCTCTC CGGTAGTCAC ACAATCGGAT TCTCGAGATG CACGAGTTTC AGACAGAGGT TGTACAACCA GTCCGGAAAC GGCAGTCCAG ACATGACATT  GGAACAATCC TTCGCTGCTA ACTTGCGCCA ACGGTGTCCA AAATCCGGTG GGGACCAGAT TCTCTCGGTG CTAGACATCA TCAGCGCCGC GAGCTTCGAC AACAGCTACT TCAAGAACTT  GATAGAGAAC AAGGGGTTGT TGAACTCGGA CCAAGTTCTG TTCAGCAGTA ACGAGAAATC GAGAGAGCTT GTGAAGAAGT ATGCAGAAGA TCAAGGAGAG TTTTTTGAGC AATTTGCGGA  ATCGATGATC AAGATGGGAA ATATCTCTCC CTTGACAGGT TCTAGTGGCG AAATCAGGAA GAATTGCAGG AAGATTAACT CTTGATTGAA ACAAGAAAAC TCTTCTTATA TCTTGTGGAA  CAAATGTGAG ACATTTACTT TTACTTTGGA GTGTGTTTTG TTTGTTTTTT TCAATTCTGT CATTTGGAAG TTTTATTTCG TGTTATTTGC GTTGTGTTAA GACATAAGTT TGAAATTTAT 
AAAACTTGTA CGAGG 

Retrieve as FASTA