Entry information : AtPrx50 (At4g37520 / PER50 / AtperoxP50 / PRXR2 / ATP9a / AtP9 / Atprxr2ge)
Entry ID 216
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: AtPrx50 (At4g37520 / PER50 / AtperoxP50 / PRXR2 / ATP9a / AtP9 / Atprxr2ge)
Name (synonym) AtPrx50 (At4g37520 / PER50 / AtperoxP50 / PRXR2 / ATP9a / AtP9 / Atprxr2ge)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Green siliques
Leaves
Mixed tissues
Roots
Seeds
Siliques
Inducers Dark growth
Drought
Hormon treatment
Pathogen interaction
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx50
start..stop
S start..stop
AhalPrx33 627 0 3..329 1..327
BstrPrx06 625 0 1..329 1..329
AlyPrx50 621 0 25..329 23..327
CrubPrx73 619 0 24..329 25..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17631704..17631919 216 N° 2 17632002..17632202 201 N° 3 17632276..17632441 166 N° 4 17632654..17633060 407
join(17631704..17631919,17632002..17632202,17632276..17632441,17632654..17633060 )


exon

Literature and cross-references AtPrx50 (At4g37520 / PER50 / AtperoxP50 / PRXR2 / ATP9a / AtP9 / Atprxr2ge)
Protein ref. UniProtKB:   Q43731
DNA ref. Phytozome 12:   Chr4 (17631704..17633060)
mRNA ref. GenBank:   NM_119916
Cluster/Prediction ref. Phytozome Gene 12:   19647714 UniGene:   At.22541
Omic ref. AtProteome:   At4g37520 ATTED-II:   At4g37520 e-FP Browser:   At4g37520 ePlant:   At4g37520 Genevestigator:   At4g37520 TAIR:   At4g37520
Protein sequence: AtPrx50 (At4g37520 / PER50 / AtperoxP50 / PRXR2 / ATP9a / AtP9 / Atprxr2ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   35939.32 (33271.8)  
PI (pH):   %s   8.78 (8.89) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVVNKTNLLLLLLSLCLTLDLSSAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTNNNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDVVNLAGGPQYDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAHTLGFAHCTKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNIDPRVAINMDPTTPRQFDNVYYKNLQQGKGLFTSDQVLFTDRRSKPTVDLWANNGQLFNQAFINSMIKLGRVGVKTGSNGNIRRDCGAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), 9 cDNA and 79 ESTs. Shorter alternative prediction from Phytozome (not confirmed by ESTs). Mainly from roots and green siliques.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGAAAAACA TACCGGAAAT GAGATCCTCT CTTTCTAAGT AATTATTGGC GTTATAACTT TCATCATAAA TCATAAGCAC GGCTTATAGG TATACATGTC ACTGAAACTT GTATCAAAAC  ATGTAACTAA CAAATATCAT TAGTTATTGT ATATATATAA ACAAAAATGC TATGACAGGA AGCAATCTAA AGACTATACT CATTAACGAA TTAGGTTCTA CAATTACACT CGATCACATA  AATTTCTGTT TTATATTTAT TACAAACCCA TGTATGTGTA GAGTCTATAG TTTAATAGTG TTTAATTAAA ATTTATCACA AACCCATGTA TGTGTAGAGT TTAATAGAGA AGGAAAATTT  TAGTGAATCG CTAAGGTAAT GACAAGATAC AATGATACAT GCATTCTAAG TAACTCCATG CGAAACGATC CTAATATTGA CTTACAAACA TATAGCATTT TGGCTGTAGT ATATTTAATA  ATGTTGTAGG ACACAACATG TAGATTAATT GATTAAAGAC AACGTGCATG TCTCTTTTTT TTCTCTATGA TGCGGGCCTT TTAGCAGAGG AATGCTACAG ACATGTAAAG TTTTGATAAA  ATTGAATAAT TAGCTAATTA TGGCCTGACT TGTTTAACCT CTATATCCAG AATGAACATT ATATTGAAAA CTGATCTTTC CACAACTATA TATGTAATAT AGTTTTTTTT GTTTTGTTGC  ATTCTGATCT CGTCATTCTG ATGTAATATA GATCCTTGCC ATCATAAAAA AAAATGGTAA TCGATTTTTA GTTAAGTATG AAGTTGTCCT CTTAGTTTAA AATTACAGTC AGCGCAAATG  AATTATCTTC CCAGAAATCA ATTAATTTTC TTGCATTTTA AAAAGCCAGA CATAAAGTTT TGACTGATTA AGACATACAT GTATATATAT GGTTAAATGA TTTATCATTT TTCTCGATCG  ATTGGATAAA GGACATGGTT TTCTTAGAAA AGAATATAAG ATAAATGACA AATAACAGAA AGAAGCGTGA TTGCCTTTAC TTGCATGCAG ATGCAGTAGT CTCCCATTTT GAATGACTGC  TCTAAACTCT TAAAGTATAA CTATTCTCGT CAACTAAAGT TTTTGTTTCT TTTTTAAACG TCAACTAAAG TCTATATCAA TAACAATAAT TTATCGCCTA ACCAGTAACC ATAGATAAAG  AAAACTTTAA ATCTAGAAAC CATTAGCTTC TGAAACAAAG TAAAACAGCC CTTAATAAAG CCATGACCAT GTCAACTGTT TCGGACCATG TGTAGTGTAC GTAGTAAACA TTTAAATTGA  TAATGAAATA GCAAGACGCA AATGGACGTT TGTAAAAATT GTATGGTTGG TAAAAAAGAC ATGAGGCTAT ATATGAATTT CTGTCATTAA ATCAGCTTTA GGTATTACTT GTTAGGATTA  AGGTTATCGT AGTTGATTAG ACTAATTAAC TAATATATGA ACCAAAAAAG TATAATAGTC AGGAGTAGTA GTTGAGATTT CAAAAAGATT CAAGGTGGCC ATAACACAAA TATTATTCGC  AATGACAAGT GAAGCATCGT TTTCACTTTT CAACTTATCC CTCTCAATCC CCACCACCAC CACTCTCTAT TCCCTCATAT AGATAGATCA TCCTAGTGAT CATATACACA CACAAACATT  GATAGAGAAC AAAACGAAAT TGGAAAAATT CATTTTAAAT TTTAAAAATA CAAAAATAAT GGAATTGGAA AAAGTCTTTT TTTTGTAAAT ACTAATCAAA TATTTTAAAA TTAACAAAAA  ATTCAATAGT AAAAAAAAGC CATCAAAAAA TGATGTCAAC AATTAGATAA GTATTTAGTC TTTTTCTCTT TTAAAAAATG ATATGCAAGC TGGCCGGCGC TACTTGTGCG CACACATAAA 
AGCATATATA TAAGATCCCT CACTCGATTC ATGTAATTAT ACACATATAG AGAGATTGAG TGAAAATATT TTTTTTTAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTAAATATA TCTGTATTAG ATTTTGTTTA TTGTATTTGG GTATAGGATG GGTCATGGGT CTCATAAAGC TGGTTCAGCT AAATTGAAAA TTGTAATAAA TCTCTGTCTT GGGTTTCAGT  TTGCAAAACC TAAACTGTAA TTATAGAGTG GAGGAAATAA GAAGTATCGT ATAATATTTA TCAAGGGATA AATACAGGCC ATCCATTATG GGCCGCGTAA GAGCCAATGC CAAATTTTAA  GAATTTTCTT AAACAAATTA TTATGAAAAA GGACCAAGAA TGCTGGATGC TCCTACATAC ATATAAAGTT TTGATAAAAT TAAAATAATT AACGTCTATA TCCAGAATAA AGTCAATGAG  CATTATATAT CCAAAACTGA TCTTTCCACA ACTATACAAT ATGGATGTGT TTTTTTTTTC TTTTGGTTGC ATTCTGATAT GTTCCTTCCT CTTGTCTGCA GCGATTACTT GTTATTTTGG  GTTATTCGTG GAAATACAAT TCAACCATTT GTTTTGAACG TGTAAGATAA GTAATATATG GTTAAATTAT TTACCATTTT TCTCAATCGA TTAGACAAAG GACCTGGTGT TATTAGAATA  TAATATAAAT GACAAACAAC AGAAAGAAGC GTGATTGCCC TTACTTAGAT TTTTTTGGAC AAACCCATAC TTAGATTAGA TGCAAGAGTA GCCCTTTTTG AATGACTGTA ATCTTGTCAA  CTAAAGTTTT TGTTTCTTTT TAAAACGTCA ACTAAAGTCC ATATCAATAG CTAATCGCCT AATCATAGAT AAAAACTTTA AAATCTATAT TAAACCATTA GCTTCTGAAA TAAAGTAAAA  CAGCCCTAAA TAAAACCATG ACCATGTCAA CTAATTCGGA CGACCATGTG TCCATGTGTA GCTTTTCTTT TCTAGAACTA CGAGATCCAA AATTAAGCAG TGTTTCATAA CGAAATAACT 
ACCGAATGTA ATGAATTTGA TGGATAGATG ATCATGTTAT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGTGGTGAACAAAACGAATCTCTTATTGCTTCTTCTCTCTCTATGTCTCACCCTCGACCTCTCCTCCGCACAACTCCGCCGTAACTTCTACGCCGGAAGTTGTCCTAACGTCGAA
CAAATCGTTAGAAACGCCGTACAGAAAAAAGTCCAACAAACTTTCACCACCATTCCCGCCACTCTACGCCTCTATTTCCATGATTGTTTCGTCAAT
GTAAAACATATTTTTTATTGATAT
TATTTTCTTGCGTAAAATTATCCATTATTTGGTCTAAATAATTGATTAATATTCATAGGGGTGTGATGCATCAGTGATGATAGCGTCAACAAATAATAATAAGGCGGAGAAGGATCATGA
GGAAAATTTATCGTTGGCCGGAGATGGATTCGACACCGTCATTAAAGCTAAAGAAGCTCTCGATGCCGTCCCAAATTGTCGTAACAAAGTTTCATGCGCTGATATTCTCACGATGGCCAC
TCGTGACGTCGTTAATCTT
GTTAGTAACTCAAGCTTATTTATTCTATTAAATTAAAACATTAGTATAAGTTATTACATTAAATTCAATATAGGCGGGTGGACCACAATACGACGTGGAAT
TGGGAAGGCTAGATGGACTATCATCAACAGCGGCTAGCGTCGGAGGGAAGTTGCCGCATCCGACCGACGATGTCAATAAACTCACTTCACTCTTCGCCAAAAACGGCCTTAGCCTTAACG
ACATGATCGCTCTCTCCG
GTAAGATTTGAACTACTTCTCGATCATAAATAGTATCATTCGAACCAAACTAATAGCTATGTGATTTAATATTCCGGTTTAGCTAACTGGATATCGGACCCG
AATTTGATTAGTATTTAAGTTGGTTTATATATACCCGAATTTGATTAGTATTTAAGTTGGTTTATATTTCCGGTCCTAATTTAGATTTCGTTTGATCTTAAACATCTCAGGGGCACACAC
ATTAGGATTCGCGCATTGCACAAAAGTGTTCAATCGGATATACACTTTCAACAAGACAACTAAAGTGGATCCCACGGTTAACAAAGATTACGTGACAGAGCTAAAAGCGTCGTGTCCTCG
AAACATAGATCCAAGAGTGGCTATTAACATGGACCCAACAACACCAAGACAATTCGACAACGTTTACTACAAAAACTTGCAACAAGGGAAAGGATTGTTCACGTCGGATCAAGTCTTATT
CACGGATCGTCGGTCAAAGCCAACCGTTGACTTATGGGCTAATAATGGACAGTTGTTTAATCAAGCTTTTATTAACTCGATGATCAAGCTTGGTCGTGTTGGTGTTAAAACTGGTAGTAA
TGGTAATATCCGTCGTGATTGTGGAGCTTTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGTGGTGAACAAAACGAATCTCTTATTGCTTCTTCTCTCTCTATGTCTCACCCTCGACCTCTCCTCCGCACAACTCCGCCGTAACTTCTACGCCGGAAGTTGTCCTAACGTCGAA
CAAATCGTTAGAAACGCCGTACAGAAAAAAGTCCAACAAACTTTCACCACCATTCCCGCCACTCTACGCCTCTATTTCCATGATTGTTTCGTCAAT
GGGTGTGATGCATCAGTGATGATA
GCGTCAACAAATAATAATAAGGCGGAGAAGGATCATGAGGAAAATTTATCGTTGGCCGGAGATGGATTCGACACCGTCATTAAAGCTAAAGAAGCTCTCGATGCCGTCCCAAATTGTCGT
AACAAAGTTTCATGCGCTGATATTCTCACGATGGCCACTCGTGACGTCGTTAATCTT
GCGGGTGGACCACAATACGACGTGGAATTGGGAAGGCTAGATGGACTATCATCAACAGCGGCT
AGCGTCGGAGGGAAGTTGCCGCATCCGACCGACGATGTCAATAAACTCACTTCACTCTTCGCCAAAAACGGCCTTAGCCTTAACGACATGATCGCTCTCTCCG
GGGCACACACATTAGGA
TTCGCGCATTGCACAAAAGTGTTCAATCGGATATACACTTTCAACAAGACAACTAAAGTGGATCCCACGGTTAACAAAGATTACGTGACAGAGCTAAAAGCGTCGTGTCCTCGAAACATA
GATCCAAGAGTGGCTATTAACATGGACCCAACAACACCAAGACAATTCGACAACGTTTACTACAAAAACTTGCAACAAGGGAAAGGATTGTTCACGTCGGATCAAGTCTTATTCACGGAT
CGTCGGTCAAAGCCAACCGTTGACTTATGGGCTAATAATGGACAGTTGTTTAATCAAGCTTTTATTAACTCGATGATCAAGCTTGGTCGTGTTGGTGTTAAAACTGGTAGTAATGGTAAT
ATCCGTCGTGATTGTGGAGCTTTTAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCTTTTTCT CTTTTAAAAA ATGATATGCA AGCTGGCCGG CGCTACTTGT GCGCACACAT AAAAGCATAT ATATAAGATC CCTCACTCGA TTCATGTAAT TATACACATA TAGAGAGATT  GAGTGAAAAT ATTTTTTTTT AAATGGTTGT GGTGAACAAA ACGAATCTCT TATTGCTTCT TCTCTCTCTA TGTCTCACCC TCGACCTCTC CTCCGCACAA CTCCGCCGTA ACTTCTACGC  CGGAAGTTGT CCTAACGTCG AACAAATCGT TAGAAACGCC GTACAGAAAA AAGTCCAACA AACTTTCACC ACCATTCCCG CCACTCTACG CCTCTATTTC CATGATTGTT TCGTCAATGG  GTGTGATGCA TCAGTGATGA TAGCGTCAAC AAATAATAAT AAGGCGGAGA AGGATCATGA GGAAAATTTA TCGTTGGCCG GAGATGGATT CGACACCGTC ATTAAAGCTA AAGAAGCTCT  CGATGCCGTC CCAAATTGTC GTAACAAAGT TTCATGCGCT GATATTCTCA CGATGGCCAC TCGTGACGTC GTTAATCTTG CGGGTGGACC ACAATACGAC GTGGAATTGG GAAGGCTAGA  TGGACTATCA TCAACAGCGG CTAGCGTCGG AGGGAAGTTG CCGCATCCGA CCGACGATGT CAATAAACTC ACTTCACTCT TCGCCAAAAA CGGCCTTAGC CTTAACGACA TGATCGCTCT  CTCCGGGGCA CACACATTAG GATTCGCGCA TTGCACAAAA GTGTTCAATC GGATATACAC TTTCAACAAG ACAACTAAAG TGGATCCCAC GGTTAACAAA GATTACGTGA CAGAGCTAAA  AGCGTCGTGT CCTCGAAACA TAGATCCAAG AGTGGCTATT AACATGGACC CAACAACACC AAGACAATTC GACAACGTTT ACTACAAAAA CTTGCAACAA GGGAAAGGAT TGTTCACGTC  GGATCAAGTC TTATTCACGG ATCGTCGGTC AAAGCCAACC GTTGACTTAT GGGCTAATAA TGGACAGTTG TTTAATCAAG CTTTTATTAA CTCGATGATC AAGCTTGGTC GTGTTGGTGT  TAAAACTGGT AGTAATGGTA ATATCCGTCG TGATTGTGGA GCTTTTAATT GATTTAAATA TATCTGTATT AGATTTTGTT TATTGTATTT GGGTATAGGA TGGGTCATGG GTCTCATAAA  GCTGGTTCAG CTAAATTGAA AATTGTAATA AATCTCTGTC TTGGGTTTCA GTTTGCAAAA CCTAAACTGT AATTATAGAG TGGAGGAAAT AAGAAGTATC GTATAATATT TATCAAGGGA 

Retrieve as FASTA