Entry information : AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Entry ID 217
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Name (synonym) AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Mixed tissues
Siliques
Stamen Abscission Zone
Inducers Hormon treatment
Stress treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx51
start..stop
S start..stop
AtPrx50 587 0 1..329 1..329
BstrPrx06 578 0 1..329 1..329
CrubPrx73 577 0 24..329 25..330
AhalPrx33 575 0 3..329 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17634786..17635001 216 N° 2 17635088..17635288 201 N° 3 17635378..17635543 166 N° 4 17635676..17636082 407
join(17634786..17635001,17635088..17635288,17635378..17635543,17635676..17636082 )


exon

Literature and cross-references AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Literature REFERENCE 1 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21
Protein ref. UniProtKB:   Q9SZE7
DNA ref. Phytozome 11:   Chr4 (17634786..17636082)
mRNA ref. GenBank:   NM_119917
Cluster/Prediction ref. Phytozome Gene 11:   19646731 UniGene:   At.28345
Omic ref. AtProteome:   At4g37530 ATTED-II:   At4g37530 e-FP Browser:   At4g37530 ePlant:   At4g37530 Genevestigator:   At4g37530 TAIR:   At4g37530
Protein sequence: AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   35852.1 (33139.5) Transmb domain:   %s   i7-25o
PI (pH):   %s   8.38 (8.20) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVMNKTNLLLLILSLFLAINLSSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDCFVNGCDASVMIASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNLAGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTLGFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNIDPRVAINMDPNTPRQFDNVYYKNLQQGKGLFTSDQVLFTDSRSKPTVDLWANNGQLFNQAFISSMIKLGRVGVKTGSNGNIRRDCGAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), 4 cDNA and 5 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACATAGATCC AAGAGTGGCT ATTAACATGG ACCCAACAAC ACCAAGACAA TTCGACAACG TTTACTACAA AAACTTGCAA CAAGGGAAAG GATTGTTCAC GTCGGATCAA GTCTTATTCA  CGGATCGTCG GTCAAAGCCA ACCGTTGACT TATGGGCTAA TAATGGACAG TTGTTTAATC AAGCTTTTAT TAACTCGATG ATCAAGCTTG GTCGTGTTGG TGTTAAAACT GGTAGTAATG  GTAATATCCG TCGTGATTGT GGAGCTTTTA ATTGATTTAA ATATATCTGT ATTAGATTTT GTTTATTGTA TTTGGGTATA GGATGGGTCA TGGGTCTCAT AAAGCTGGTT CAGCTAAATT  GAAAATTGTA ATAAATCTCT GTCTTGGGTT TCAGTTTGCA AAACCTAAAC TGTAATTATA GAGTGGAGGA AATAAGAAGT ATCGTATAAT ATTTATCAAG GGATAAATAC AGGCCATCCA  TTATGGGCCG CGTAAGAGCC AATGCCAAAT TTTAAGAATT TTCTTAAACA AATTATTATG AAAAAGGACC AAGAATGCTG GATGCTCCTA CATACATATA AAGTTTTGAT AAAATTAAAA  TAATTAACGT CTATATCCAG AATAAAGTCA ATGAGCATTA TATATCCAAA ACTGATCTTT CCACAACTAT ACAATATGGA TGTGTTTTTT TTTTCTTTTG GTTGCATTCT GATATGTTCC  TTCCTCTTGT CTGCAGCGAT TACTTGTTAT TTTGGGTTAT TCGTGGAAAT ACAATTCAAC CATTTGTTTT GAACGTGTAA GATAAGTAAT ATATGGTTAA ATTATTTACC ATTTTTCTCA  ATCGATTAGA CAAAGGACCT GGTGTTATTA GAATATAATA TAAATGACAA ACAACAGAAA GAAGCGTGAT TGCCCTTACT TAGATTTTTT TGGACAAACC CATACTTAGA TTAGATGCAA  GAGTAGCCCT TTTTGAATGA CTGTAATCTT GTCAACTAAA GTTTTTGTTT CTTTTTAAAA CGTCAACTAA AGTCCATATC AATAGCTAAT CGCCTAATCA TAGATAAAAA CTTTAAAATC  TATATTAAAC CATTAGCTTC TGAAATAAAG TAAAACAGCC CTAAATAAAA CCATGACCAT GTCAACTAAT TCGGACGACC ATGTGTCCAT GTGTAGCTTT TCTTTTCTAG AACTACGAGA  TCCAAAATTA AGCAGTGTTT CATAACGAAA TAACTACCGA ATGTAATGAA TTTGATGGAT AGATGATCAT GTTATTTTCT TAAGATAAAG GTGTCCAGAA GAAATTAATA AATATCTTAA  TTGTTCAAAA AGTGTTACAT TTTTGCCATC AAAATAGAAA AATGATGATG AAATAGCGCT AGACGCAAAT CGGAATTTTG TAAAAAAATG GTATGGTAAG TAACAAGAAT ATGAGAGAGA  GAGACTATAT GAAGTCCTTC TATCATCTTT AGTTGTTACT TGTTAAGATT GAGGTTACCG TAGTTGATTA GACTAATTAA TATTAGTTGA TCCAAAAAAG TATGATATTC AGGAGTAGTG  TAGAGATTTC GGAAAGATTC AAGGTGACCA TTACACAATA CTTAAATACT ATTCGCAATG ACAAGTGAAG CATCGTTATC AACTTCTCCC TCTCAATCCC CACCACCACT CTCTATTACC  TCATATAGAT AGATCATCCT AGTGATCATA CACACAACAT TGATAGCGAA CACCAATAGT ATGCTATATT CACAACAAAA CAAAAATGGA CTAATTCATT TGTTTTTTTG AAGTAAAGGA  ATTGAACAAT AATTATTTTA TTTTTTTTGG GAAATACTAT TCAAGTATTT GAAATTAGAA AAGTATTTAG TCTTTTTCTC TTTAAAATAT GAATGCAAGC TGGCCGCTGG CCGGCACACA 
CAGCACAAAG CATGTATATA AGATCTCTCA CTCCATTTAT GTAATTATAC ATATAAAGAG AAATTGTTTT TTTTTTTTAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTAAATATA TCTGTTTAAG ATATTGTTTA TTTGCACTCA TTTGTATTGG GATTTGGGAA TGGGATGGGT CTCATGAAGC TGGTTCAGCT AAAATGTAAT AATTCTGGTT TTGGGTTTTA  GTTTGCTATA TATCGCAAAA CTAAATTGTA GATATGGAGT GGCAAAAAGG AAATAATATA CATGATTAGT CCCAATGGGC AATGACAATA CTTTGTATAG TAAGTTGGAT CATGAGTCAT  GACTTTATAT TTGTGTAAAA TGTCAATCAT CTATTATTTC ATAAGAATGT AAGTAGACAT AATTAATCTT TGTGCTGAGA AATATAACAA AATTACATTT TACTTACAAA ATTATCAAAC  GTATTGTCAA AAAGAACTAA CACAAAATAT AGTTTCTAAT TCATATAATA TCAACTTCCG AGTTTCAACG TTTTTGTATC TTTCTTGGGA TATAACATAT AAGGCCCAAA CCGAGGCCCA  TACCATAATA AAGTAAGGAA AGCAATGGCT TTCTTTTGGG CATGTTGTAT TTTCCTTATA ACAATCTTTT GTAGCTGCTA GGCCCTTTGG CAACAGGCCC TTTTTGGAAA CAATATTAGT  TTTCGCTTTT GAAAAATGAG AATTTGTTAT GTGTAACCGT AGTTTATCCA GAGATTATAG TGGCATACTG ATGCCTATTT GGCTGCGTGA ATCCAAAACT AGGCTATAAT GATTCACAGA  GACAGAGCCA CAGTGGCATA AGCATTTTAA ACTTAAATCC AAAATACATC AATAAATCGT CAATCAAGTT ATGGTGTTAC CATTTTACTA GTAGTGGCTT AACTTAAAAA ATTTTAAGGG  GCACACAAGC CCTAGAGATT AATTGATCCA ACCAAGTTCG ACTTCACCGA CTACTTTTGA CAACAATTAG AACAGCTAAA AGACACTCTT TTCGAATTTG GAAAATCTAA TATTTTTGCT 
TAAAACTATT TTAATGAATT ATCATCACTA ATGATTAGTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGTGATGAACAAAACGAATCTCTTGTTGCTTATTCTCTCTCTTTTTCTCGCCATCAACCTCTCCTCCGCTCAACTCCGCGGCGACTTCTACGCCGGAACTTGTCCGAACGTCGAG
CAAATCGTCAGAAACGCCGTACAGAAAAAAATCCAACAAACTTTCACCACCATTCCCGCCACTCTACGCCTCTATTTCCATGATTGTTTCGTCAAT
GTAAAACAATCTTTTCTTTGATAA
AAAATGATTTCTAGCGAACTATATTTTATAATTTTCGGTAATTTATTTTATTATTATCATAGGGATGTGATGCATCAGTGATGATAGCGTCGACAAATACTAATAAGGCGGAGAAGGATC
ATGAGGATAATTTATCGTTGGCCGGAGATGGATTCGACACCGTCATTAAAGCTAAAGAAGCTGTTGACGCCGTCCCAAATTGTCGTAACAAAGTTTCTTGCGCTGATATTCTCACGATGG
CCACTCGTGACGTCGTTAATCTT
GTTAGTAACTCCCTCCATATTTATATATTATAATGTTTTATTTTAATATAAAAACATTAGTGTAAGTTATTACATTAAATTCAAAATAGGCGGGTGG
ACCACAATACGCCGTAGAATTGGGAAGGCGAGATGGACTTTCGTCGTCGGCTTCTAGCGTCACAGGGAAGCTACCCAAACCGACCTTTGATCTCAACCAACTCAATGCACTTTTCGCAGA
AAACGGTCTTAGCCCTAATGACATGATCGCTCTCTCCG
GTAAGATGATTTGAACTAGTTCTTGATCAAGAATAGTATCATTCGGACCAAACAAATTAGCTGTATGCCATGTTGTTAGCGG
TTTATATTTCCGGTCCAAATTTAGATTTCGTTTGCTCTTAAACATCTCAGGGGCACACACATTAGGATTCGCGCATTGCACAAAAGTTTTCAATCGGCTATACAATTTCAACAAGACAAA
TAACGTGGATCCCACGATTAACAAAGATTACGTGACAGAGCTAAAAGCGTCGTGTCCTCAAAACATAGATCCAAGAGTGGCTATTAACATGGATCCCAATACACCAAGACAATTCGACAA
CGTTTACTACAAAAACTTGCAACAAGGGAAAGGATTGTTCACGTCTGATCAAGTCTTATTCACCGATAGTCGGTCAAAGCCAACCGTTGACTTATGGGCTAATAATGGACAGTTGTTTAA
TCAAGCTTTTATTAGCTCGATGATCAAGCTTGGTCGTGTTGGTGTTAAAACTGGTAGTAATGGTAATATTCGTCGTGATTGCGGAGCTTTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGTGATGAACAAAACGAATCTCTTGTTGCTTATTCTCTCTCTTTTTCTCGCCATCAACCTCTCCTCCGCTCAACTCCGCGGCGACTTCTACGCCGGAACTTGTCCGAACGTCGAG
CAAATCGTCAGAAACGCCGTACAGAAAAAAATCCAACAAACTTTCACCACCATTCCCGCCACTCTACGCCTCTATTTCCATGATTGTTTCGTCAAT
GGATGTGATGCATCAGTGATGATA
GCGTCGACAAATACTAATAAGGCGGAGAAGGATCATGAGGATAATTTATCGTTGGCCGGAGATGGATTCGACACCGTCATTAAAGCTAAAGAAGCTGTTGACGCCGTCCCAAATTGTCGT
AACAAAGTTTCTTGCGCTGATATTCTCACGATGGCCACTCGTGACGTCGTTAATCTT
GCGGGTGGACCACAATACGCCGTAGAATTGGGAAGGCGAGATGGACTTTCGTCGTCGGCTTCT
AGCGTCACAGGGAAGCTACCCAAACCGACCTTTGATCTCAACCAACTCAATGCACTTTTCGCAGAAAACGGTCTTAGCCCTAATGACATGATCGCTCTCTCCG
GGGCACACACATTAGGA
TTCGCGCATTGCACAAAAGTTTTCAATCGGCTATACAATTTCAACAAGACAAATAACGTGGATCCCACGATTAACAAAGATTACGTGACAGAGCTAAAAGCGTCGTGTCCTCAAAACATA
GATCCAAGAGTGGCTATTAACATGGATCCCAATACACCAAGACAATTCGACAACGTTTACTACAAAAACTTGCAACAAGGGAAAGGATTGTTCACGTCTGATCAAGTCTTATTCACCGAT
AGTCGGTCAAAGCCAACCGTTGACTTATGGGCTAATAATGGACAGTTGTTTAATCAAGCTTTTATTAGCTCGATGATCAAGCTTGGTCGTGTTGGTGTTAAAACTGGTAGTAATGGTAAT
ATTCGTCGTGATTGCGGAGCTTTCAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAATGGTTGT GATGAACAAA ACGAATCTCT TGTTGCTTAT TCTCTCTCTT TTTCTCGCCA TCAACCTCTC CTCCGCTCAA CTCCGCGGCG ACTTCTACGC CGGAACTTGT CCGAACGTCG  AGCAAATCGT CAGAAACGCC GTACAGAAAA AAATCCAACA AACTTTCACC ACCATTCCCG CCACTCTACG CCTCTATTTC CATGATTGTT TCGTCAATGG ATGTGATGCA TCAGTGATGA  TAGCGTCGAC AAATACTAAT AAGGCGGAGA AGGATCATGA GGATAATTTA TCGTTGGCCG GAGATGGATT CGACACCGTC ATTAAAGCTA AAGAAGCTGT TGACGCCGTC CCAAATTGTC  GTAACAAAGT TTCTTGCGCT GATATTCTCA CGATGGCCAC TCGTGACGTC GTTAATCTTG CGGGTGGACC ACAATACGCC GTAGAATTGG GAAGGCGAGA TGGACTTTCG TCGTCGGCTT  CTAGCGTCAC AGGGAAGCTA CCCAAACCGA CCTTTGATCT CAACCAACTC AATGCACTTT TCGCAGAAAA CGGTCTTAGC CCTAATGACA TGATCGCTCT CTCCGGGGCA CACACATTAG  GATTCGCGCA TTGCACAAAA GTTTTCAATC GGCTATACAA TTTCAACAAG ACAAATAACG TGGATCCCAC GATTAACAAA GATTACGTGA CAGAGCTAAA AGCGTCGTGT CCTCAAAACA  TAGATCCAAG AGTGGCTATT AACATGGATC CCAATACACC AAGACAATTC GACAACGTTT ACTACAAAAA CTTGCAACAA GGGAAAGGAT TGTTCACGTC TGATCAAGTC TTATTCACCG  ATAGTCGGTC AAAGCCAACC GTTGACTTAT GGGCTAATAA TGGACAGTTG TTTAATCAAG CTTTTATTAG CTCGATGATC AAGCTTGGTC GTGTTGGTGT TAAAACTGGT AGTAATGGTA  ATATTCGTCG TGATTGCGGA GCTTTCAATT AATTTAAATA TATCTGTTTA AGATATTGTT TATTTGCACT CATTTGTATT GGGATTTGGG AATGGGATGG GTCTCATGAA GCTGGTTCAG 
CTAAAATGTA ATAATTCTGG TTTTGGGTTT TAGTTTGCTA TATATCGCAA AACTAAATTG TAGATATGGA GTGGCAAAAA GGAAATAATA TACATGATTA GTCCCAATGG GCAATGAC 

Retrieve as FASTA