Entry information : AtPrx53 (At5g06720 / PER53 / AtperoxP53 / ATPA2 / Atpatpa2a)
Entry ID 219
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-04 (Christophe Dunand)
Peroxidase information: AtPrx53 (At5g06720 / PER53 / AtperoxP53 / ATPA2 / Atpatpa2a)
Name (synonym) AtPrx53 (At5g06720 / PER53 / AtperoxP53 / ATPA2 / Atpatpa2a)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Nectaries
Roots
Rosettes
Siliques
Stamen Abscission Zone
Inducers Abscissic acid treatment
Abscission
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx53
start..stop
S start..stop
CagraPrx62 641 0 1..335 1..335
AlyPrx53 639 0 1..335 1..335
AruPrx53-1 635 0 1..335 1..336
AruPrx53-2 633 0 1..335 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2078627..2078857 231 N° 2 2078336..2078527 192 N° 3 2078065..2078230 166 N° 4 2077567..2077985 419
complement(join(2077567..2077985,2078065..2078230,2078336..2078527,2078627..2078 857))


exon

Literature and cross-references AtPrx53 (At5g06720 / PER53 / AtperoxP53 / ATPA2 / Atpatpa2a)
Literature REFERENCE 1 Kupriyanova EV, Ezhova TA, Shestakov SV. Duplicated peroxidase genes AtPrx53 and AtPrx54 of Arabidopsis thaliana are a recombination hotspot. Dokl Biochem Biophys. 2010 Mar-Apr;431:90-3.
REFERENCE 2 Jin J, Hewezi T, Baum TJ. Arabidopsis peroxidase AtPRX53 influences cell elongation and susceptibility to Heterodera schachtii. Plant Signal Behav. 2011 Nov;6(11):1778-86.
REFERENCE 3 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21.
Protein ref. UniProtKB:   Q42578
DNA ref. Phytozome 11:   Chr5 (2078857..2077567)
mRNA ref. GenBank:   NM_120755.2
Cluster/Prediction ref. Phytozome Gene 11:   19669507 UniGene:   At.93
Omic ref. AtProteome:   At5g06720 ATTED-II:   At5g06720 e-FP Browser:   At5g06720 ePlant:   At5g06720 Genevestigator:   At5g06720 RnR:   At5g06720 TAIR:   At5g06720
Protein sequence: AtPrx53 (At5g06720 / PER53 / AtperoxP53 / ATPA2 / Atpatpa2a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   34880.28 Transmb domain:   %s   i12-34o
PI (pH):   %s   4.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVTNLPTCDGLFIISLIVIVSSIFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDTGSIQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVLLGRRDSLTANLAGANSSIPSPIESLSNITFKFSAVGLNTNDLVALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSNDGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRLDCKKVNGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns), 5 cDNA and 18 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCGAAGGC CTTAACAACA TCACATCAAA ATTTGTAGCT GTCGGGCTAA AGACAACCGA TGTAGTATCC TTGTCTGGTA AATCATCAGA CATGTTTAAT TACTTGCAGC TCACTTCAAA  CAAAACCCTA ATTAATGACA ACTCTGTTGT TGTTCAATAT GCATAGGAGC GCATACGTTT GGGCGTGGTC AATGCGTAAC GTTCAACAAT AGACTATTCA ACTTCAACGG GACAGGAAAC  CCCGACCCGA CTCTGAACTC AACACTTCTC AGCAGTCTTC AACAGCTATG TCCTCAAAAC GGCAGCAATA CAGGGATCAC CAATCTCGAT CTGAGCACAC CTGATGCGTT CGATAACAAT  TACTTCACGA ACCTTCAGAG TAACAATGGG CTTCTCCAGT CAGACCAGGA ACTGTTCTCA AACACCGGTT CAGCCACCGT CCCGATTGTT AATTCCTTTG CAAGTAACCA GACCCTGTTT  TTTGAGGCGT TTGTTCAGTC TATGATCAAG ATGGGGAACA TTAGTCCCTT GACTGGGAGT AGTGGAGAGA TTAGACAAGA CTGTAAGGTG GTTAATGGAC AGTCATCAGC CACTGAAGCA  GGGGACATTC AGTTACAATC TGACGGACCA GTGAGTGTAG CAGATATGTG AACAACGATG AGATCAGTTT CACCGTTTGT TTATCATATA TGAATAATAA CTCCTAGGCC GAATCATTTT  TGTGAAAAAA ATAAGTTTGG TTGAGGAGAA AATAAGTGAG TGGTAGGGTT GTGTTTTACA CTTTTGAAAA TTTTAATATT CTAAAACATT ATTATGCCTA AATACATGCA TGCATGTATA  ACGTCTATCG TTTTGATACA TTTTGTGGAT TTGAATCTAA ATTGTGTCAC AACGACAAAA TTTAAAAGAA TAAAATAAAA AACTAGATTC ATGTCATGAT TTATCAAATC TAATGTTTTT  AGTGTCAATC AATGGAAAAA ATTATAATTC ATGAGAAATA AATAGAAGTA CGGCAAAGTG ATTTGAAACA TAGGTTCATA TTTTGAAAAA TGGGAAGCAA AATCTATTAA TAGATTTCAT  AATATTATAA GATTCATAAT CCTTAAGTTA CTTGCGCATT TTGATTGTTT ATTATTCTAT GAGTTAATGT CAAAGGAACA TCTCCAAAAG TGATCGTAAG TAAGACTTTT GCAGATTCTT  CATCAAAATC AGTGAAGTAA TAACAACTCA TTATAAAAGG CTTGATTATG AATCCTTTTC TGGTTTTCTG AAAGTACAGC TGTAAAGCTC CAACAACTAT TGAAGGCAGC AGTTCTTTCA  AATATTAGTT ATCATTCACA GAATTGTGAC TTATAACTAA AACTTTAGAC TAACATTTAA AAAACTTATC TAAAAATTTT GCGTATTCCT TGTGACAATT GAGAACTCCT TTCACAATCT  CATATATATG AAATTTCCCT TGATTAAACG TGGGAATCTA AATGCATTAA TCATTATAGA TGTTGGCTTA TAAATTTAAT TTTGAGATTG AAATGTGGCC ATATCATGTT TTAGTGTATT  CATTTTATAA AAGAAAGAAA CAAAAAAAAA AAATCTTGAT TTTCTTGACC ACCGATTTCG TCTCACGCAA AATCCTGTAT AAATTATAAA AACTATATAT AACTTCATTT ACCAACCGCG  TGGGAGGATT ACAATAATGC AATTGATGGA GATAGTATAA CCTAAAGACA AATTACTTTT AACTAAACAA AATGTAGAAG CACCAGCTTT CTTTTCCCAT CTTTTGGACT ATGTAGACAA  ACACACACGT TAATCTATAG TTATTGGCTT AATTTCAAAA TCTTTCACTT TCATGATCAG TCAAGAAATA CGCGTTTAAT CGACTTTTTC TCTCTATATA TACAATTCTT TCAAAATGAT 
CAAACATAGT CATAAGTTCC GCACCAATCA GTGGAAATAA CTAATCAAAA CTCTGTATCA TCGTTTTCAA AACCTAATTA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCCTTAAA GCTCATTTTC TTTGAAAAAA CATTGGCAAG CTTTGGTTGA ATAATTTTTG TTATCATAAT CACATCAAAT CTGTATTGCA CTTAAATCAT TCTAAGCAAA TTTATGATAA  ATGAAATTAA ATCAAAACAA CAGAAAATCA GCAAAATATT TAACAGTTTT ACTATTATTA ATGGAACATT CTCTTTATCT TTGCATTCAC AGAGAAGAAT GCAGAAAATT GAAAGTTTTC  ACTTTAGTAA TAAGAACAAC TTTATTTTGT GGGCTCCAAC AGAGAATTAT CATTGACAAA TTATTTTACG AATCACCAAT CAATAACGAT AACAAAAAAA AAAAAAAAAC CGTCCAACAT  GTTAATCGAA TTATCTATCA ACCATCATTA CAGTCCTTGT GGAATGATTT CGCCGACAAA TAAAAAATTT CATTTGAAAT TTAGGGGAGA CATAAAATAA TTCGGTAGGC TGATTTTGCG  GTCAAAATAA AGCGGTCCCT TTCCACGCCA AACTGCCGAA GACGAGAGTG CTTGATTCTC TAATTTTCCT CTAGAGTACT ATTGATTTTA TTTTTTGACA GGAACTATGA ATTTTCGGCT  GTAAATGTAA ATATTAATTC ATTAATGACA AATAATATTA TTCTATTTTA TAAAGTAAAA TAAAAAATAA GAACTTAATA ATTATCTCAA AAAATGTTGA CAAAAATAAA TTTGTTCAAG  AATACCAATT TAAAAAAAAA ATAGGTATAG AAATTAGGTT ATATTTTTCT TATCTTCTCA CACACACAGA GACATACATA TATACGGATG AAAGTCATGA TCTATATTTA TATGTTTATT  ATTTAGGTAT CATCATCGCC TCTATTACCT ACATATAAAT AAAGCAATAA AAATGTAAAT ATACTCTCAT ATATATATTG AGTTACCAGC GGAAAAAAAT ACGCAGTTCT CTGAATTCGT 
TAATTTATTA TATATAATGA ATGTGGAGTT ATTATTGGGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAATCTTCCTACTTGTGATGGTTTGTTCATTATCAGTCTTATTGTCATCGTTTCTTCAATATTTGGGACATCATCTGCGCAACTAAACGCAACATTTTACTCTGGGACT
TGTCCCAACGCCTCTGCCATCGTACGCAGCACTATTCAGCAAGCTCTTCAATCCGATACAAGAATCGGAGCCAGCCTCATCCGCCTTCATTTTCATGACTGTTTTGTTAAT
GTATACTAA
TATTTTCGACGCAACTGTTTAACATCAATTAAGCCATGTTGTAATTTTCGCCCTAAACCTACTTTGCCTTCTTTATTATATATTCTGAAGGGATGTGATGCATCGATCTTGCTTGACGAC
ACTGGAAGCATCCAGAGCGAGAAGAACGCTGGTCCGAATGTAAACTCAGCTAGAGGATTCAACGTTGTTGATAATATCAAGACTGCCCTCGAAAACGCTTGCCCTGGTGTTGTCTCTTGC
TCTGACGTTTTAGCCCTTGCCTCTGAGGCTTCTGTGTCTTTG
GTAACTCTACACGTTCTTTGTGGACATATGAAACAAAACATAACTAAAAATTACTGTGGTATAATTCTATTTAGTTAT
TGTTAAGATACGTTTGATCATCTTCAGGCAGGAGGGCCATCATGGACTGTATTATTAGGAAGAAGAGATAGTCTCACGGCCAACCTCGCCGGTGCAAATTCGTCCATTCCTTCTCCCATC
GAAAGCCTAAGCAACATCACATTTAAATTTTCGGCTGTCGGGCTTAATACAAACGATCTGGTAGCCTTATCTG
GTAAGTTCATCTAAATGTTTAGTTACTTGCGTCTCAAGTTGAAACAA
ACCCTAACGCCAACTCTTGTGGATCGACGTAGGTGCGCATACGTTCGGGCGTGCTCGATGTGGAGTATTCAACAACAGACTATTTAACTTCAGCGGGACAGGAAATCCCGATCCAACTCT
AAACTCAACGCTTCTGAGCACTCTTCAACAGCTATGTCCTCAAAACGGTAGCGCATCAACGATCACCAATCTTGATTTGAGCACACCAGATGCGTTCGATAACAATTACTTCGCCAACCT
TCAGAGCAACGATGGACTTCTTCAGTCAGACCAAGAGCTGTTCTCTACCACCGGTTCATCCACCATCGCGATTGTTACTTCGTTCGCAAGTAACCAGACTCTGTTTTTTCAGGCCTTTGC
ACAGTCCATGATCAATATGGGGAATATTAGTCCCTTGACTGGGAGTAATGGAGAGATTAGGTTAGACTGTAAGAAGGTTAATGGAAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAATCTTCCTACTTGTGATGGTTTGTTCATTATCAGTCTTATTGTCATCGTTTCTTCAATATTTGGGACATCATCTGCGCAACTAAACGCAACATTTTACTCTGGGACT
TGTCCCAACGCCTCTGCCATCGTACGCAGCACTATTCAGCAAGCTCTTCAATCCGATACAAGAATCGGAGCCAGCCTCATCCGCCTTCATTTTCATGACTGTTTTGTTAAT
GGATGTGAT
GCATCGATCTTGCTTGACGACACTGGAAGCATCCAGAGCGAGAAGAACGCTGGTCCGAATGTAAACTCAGCTAGAGGATTCAACGTTGTTGATAATATCAAGACTGCCCTCGAAAACGCT
TGCCCTGGTGTTGTCTCTTGCTCTGACGTTTTAGCCCTTGCCTCTGAGGCTTCTGTGTCTTTG
GCAGGAGGGCCATCATGGACTGTATTATTAGGAAGAAGAGATAGTCTCACGGCCAAC
CTCGCCGGTGCAAATTCGTCCATTCCTTCTCCCATCGAAAGCCTAAGCAACATCACATTTAAATTTTCGGCTGTCGGGCTTAATACAAACGATCTGGTAGCCTTATCTG
GTGCGCATACG
TTCGGGCGTGCTCGATGTGGAGTATTCAACAACAGACTATTTAACTTCAGCGGGACAGGAAATCCCGATCCAACTCTAAACTCAACGCTTCTGAGCACTCTTCAACAGCTATGTCCTCAA
AACGGTAGCGCATCAACGATCACCAATCTTGATTTGAGCACACCAGATGCGTTCGATAACAATTACTTCGCCAACCTTCAGAGCAACGATGGACTTCTTCAGTCAGACCAAGAGCTGTTC
TCTACCACCGGTTCATCCACCATCGCGATTGTTACTTCGTTCGCAAGTAACCAGACTCTGTTTTTTCAGGCCTTTGCACAGTCCATGATCAATATGGGGAATATTAGTCCCTTGACTGGG
AGTAATGGAGAGATTAGGTTAGACTGTAAGAAGGTTAATGGAAGTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCAGTC AAGAAATACG CGTTTAATCG ACTTTTTCTC TCTATATATA CAATTCTTTC AAAATGATCA AACATAGTCA TAAGTTCCGC ACCAATCAGT GGAAATAACT AATCAAAACT  CTGTATCATC GTTTTCAAAA CCTAATTAAT GGCTGTAACA AATCTTCCTA CTTGTGATGG TTTGTTCATT ATCAGTCTTA TTGTCATCGT TTCTTCAATA TTTGGGACAT CATCTGCGCA  ACTAAACGCA ACATTTTACT CTGGGACTTG TCCCAACGCC TCTGCCATCG TACGCAGCAC TATTCAGCAA GCTCTTCAAT CCGATACAAG AATCGGAGCC AGCCTCATCC GCCTTCATTT  TCATGACTGT TTTGTTAATG GATGTGATGC ATCGATCTTG CTTGACGACA CTGGAAGCAT CCAGAGCGAG AAGAACGCTG GTCCGAATGT AAACTCAGCT AGAGGATTCA ACGTTGTTGA  TAATATCAAG ACTGCCCTCG AAAACGCTTG CCCTGGTGTT GTCTCTTGCT CTGACGTTTT AGCCCTTGCC TCTGAGGCTT CTGTGTCTTT GGCAGGAGGG CCATCATGGA CTGTATTATT  AGGAAGAAGA GATAGTCTCA CGGCCAACCT CGCCGGTGCA AATTCGTCCA TTCCTTCTCC CATCGAAAGC CTAAGCAACA TCACATTTAA ATTTTCGGCT GTCGGGCTTA ATACAAACGA  TCTGGTAGCC TTATCTGGTG CGCATACGTT CGGGCGTGCT CGATGTGGAG TATTCAACAA CAGACTATTT AACTTCAGCG GGACAGGAAA TCCCGATCCA ACTCTAAACT CAACGCTTCT  GAGCACTCTT CAACAGCTAT GTCCTCAAAA CGGTAGCGCA TCAACGATCA CCAATCTTGA TTTGAGCACA CCAGATGCGT TCGATAACAA TTACTTCGCC AACCTTCAGA GCAACGATGG  ACTTCTTCAG TCAGACCAAG AGCTGTTCTC TACCACCGGT TCATCCACCA TCGCGATTGT TACTTCGTTC GCAAGTAACC AGACTCTGTT TTTTCAGGCC TTTGCACAGT CCATGATCAA  TATGGGGAAT ATTAGTCCCT TGACTGGGAG TAATGGAGAG ATTAGGTTAG ACTGTAAGAA GGTTAATGGA AGTTGATTTC CTTAAAGCTC ATTTTCTTTG AAAAAACATT GGCAAGCTTT 
GGTTGAATAA TTTTTGTTAT CATAATCACA TCAAATCTGT ATTGCACTTA AATCATTCTA AGCAAATTTA TGATAAATGA AATTAAATCA AAACAACAGA AAA 

Retrieve as FASTA