Entry information : AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Entry ID 220
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Name (synonym) AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Hypocotyls
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx54
start..stop
S start..stop
AlyPrx54 681 0 1..358 1..357
AruPrx54 660 0 1..358 1..358
BstrPrx43 655 0 1..358 1..358
CagraPrx23 632 0 1..358 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2081388..2081621 234 N° 2 2081103..2081294 192 N° 3 2080781..2080946 166 N° 4 2080207..2080691 485
complement(join(2080207..2080691,2080781..2080946,2081103..2081294,2081388..2081 621))


exon

Literature and cross-references AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Literature Kupriyanova EV, Ezhova TA, Shestakov SV. Duplicated peroxidase genes AtPrx53 and AtPrx54 of Arabidopsis thaliana are a recombination hotspot. Dokl Biochem Biophys. 2010 Mar-Apr;431:90-3.
Protein ref. UniProtKB:   Q9FG34
DNA ref. Phytozome 12:   Chr5 (2081621..2080207)
mRNA ref. GenBank:   NM_120756
Cluster/Prediction ref. Phytozome Gene 12:   19668053 UniGene:   At.90
Omic ref. AtProteome:   At5g06730 ATTED-II:   At5g06730 e-FP Browser:   At5g06730 ePlant:   At5g06730 Genevestigator:   At5g06730 TAIR:   At5g06730
Protein sequence: AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (327)
PWM (Da):   %s   37136.17 (34027.6) Transmb domain:   %s   i13-35o
PI (pH):   %s   4.33 (4.39) Peptide Signal:   %s   cut: 32 range:32-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVTSSSSTCDGFFIISLIVIVSSLFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGGSLIRLHFHDCFVNGCDGSLLLDDTSSIQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILALASEASVSLAGGPSWTVLLGRRDGLTANLSGANSSLPSPFEGLNNITSKFVAVGLKTTDVVSLSGAHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQNGSNTGITNLDLSTPDAFDNNYFTNLQSNNGLLQSDQELFSNTGSATVPIVNSFASNQTLFFEAFVQSMIKMGNISPLTGSSGEIRQDCKVVNGQSSATEAGDIQLQSDGPVSVADM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns), 7 cDNA and 10 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTGGTCAA AACATCTTCA GAATTTTTAA AATACCCAAG ATATTTCTAT GTAACTAATT AATGTTCAAG AGGTTTTAAT GTAATTAATC AAACCCGAGT ATGAATGAAA ATAACAATGT  CTACAACTTT TAGTCAATCT TGAGCAGCTA TCATCAGTTT GTTATTAATT ACTATAATAT ATATAAAACT AACTTTGGAA TGAGGTAGCT AACATGTGAA AATTCATATA AAGCTACAAC  TTGTTCTATT TTATAGTGAC TTCTATCAGA TATTCATATT CGCTTGGGGA GGCTCTCGGC AACAACATTT TTATTATCAT TTTCCTTTGA ATTCTCAAAT TCAACATACG ACTGATATAA  CTGTATAAGA TAAGATATTT AGACCCTGCT TTGTTAACTT CTACACGTTT AAAAAAAAAA AAATTAATGG TGAACTATGT TACATCACAA TAGACGTGTA CTGCACAATT TTTTATTTCT  TTTGAATGAA ATTTTTAAAC ATGCTTGACA CAATCAGACA TGAAAGACAA AGCTATTTGT ATAAGAGTAA AATAATGAAC AAATAATTTA TAGATGTAAG GAAAATTATC AATGAACATT  AATTCTTGCA AGTTTTTCGA CAAAAGATAT GCTTGAATAA CTATTACAGT CTGTTAAGTT TATAGTAGTA TATGGATAAA TTCTTAACGA AGAAGTAATG ATGATATTAA GAAGAGTTTG  GATGGTCCAG AAGCATAATG AATGATTGGA TTTAAACGCA CATGGAGAGT TGGTGATGAC ATTCTGAAGT GCAAACCAAA TAGAATGAGC TGAAAAGATT TCGAATATTT GGATCCGATC  GGCTAAAGCA GTGTAGACGC TTGACCAAGG ATAGAAAAAG AATAATATTG GGGAAGTTTT TGAAACTTTA CATATAAAGT AAAATTGAGA TATGTCCAGT GAGGAAGATG AAGAACTATA  ATTTCAAGCA ACAAGGAAGA ATAAATGTTT ATCAAAAAAA GAAAAACAAA AAACAAGGAA GAATAAAGGC GGTATGTATT TTACTTAGGA CTAATGAACT AAGCATATTG TGTTATATGC  ATGATTTTTT TTTTTTTTTA CCGTGAATAA AAAAAGTTAG TGGTGTGACC AAGGTGGCTA AGTCAGTCAT TTTAACCTAA TTTTTTACGA TCGAAAAATA TCACAGAAGC GCTCAGATCG  CAGTGGAGAG TTCGTTAGTT TTTTTTTAAT CAAATCTGTT CATCATCTAT TTGAGACTGG TTTTATGGAC TTTTTAATTT CCGATCGAAG CAAGTTCCAT TATTTCGTTT GCTATATATG  GCCTTCACTG AATATCCAAA TTTTTGTATC ATCAATTGGA TATTCTTATA CGTAAAGATT AATTTGTTAG TATACTTGAA ATTTTCCTAA TATTAAATTT CTATAGATTT TTTCGAGTTA  TATATAATCT TATTAATATG TTTTGATGTG CTGGTAAACT TGTACGTTAG TTTTTTTTTT TTTTTCAATT TACGTTGCGA CCAATTATTT GTTAGTGTAC GTTGATCATT TTTTCAGTTT  GTGTTTAGTT GAAGATCTAA AAAGGATTAT AAAGATATTG TAAAATTAAA AAAACATCTG TAAGTTAAAA AAACATATAC AGTTGTAAAG TGCCCTAACA ACTAACAACT CTTTCACGTT  ATTTACTTTT CGTGGAACGT GACTATATGA CACGAATCTT GTAGACTCAA TTTTTCTAAC GTTAATGACT AATTAAAACA CGCACTACAT AAAAATCTAG AAGCGCCATC TTTTCTCACT  TTTTGACTTG GTAAAACAAC ACGCACCTTG ACTAGTAATT ATTAGCTTAA GTTAAAATCT GTTACATTCC TGATCAGGTA AGATTTATTC AGCTTTTATC CTCTATATAA TGACTAATTA 
GATTAATCAT AAGTTCAGAA TCAATCAGTA AAACGAAAAG CTAATCCAAA ACTCTTTAAT TATTTGCAAC AACTGATCA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAACGATGA GATCAGTTTC ACCGTTTGTT TATCATATAT GAATAATAAC TCCTAGGCCG AATCATTTTT GTGAAAAAAA TAAGTTTGGT TGAGGAGAAA ATAAGTGAGT GGTAGGGTTG  TGTTTTACAC TTTTGAAAAT TTTAATATTC TAAAACATTA TTATGCCTAA ATACATGCAT GCATGTATAA CGTCTATCGT TTTGATACAT TTTGTGGATT TGAATCTAAA TTGTGTCACA  ACGACAAAAT TTAAAAGAAT AAAATAAAAA ACTAGATTCA TGTCATGATT TATCAAATCT AATGTTTTTA GTGTCAATCA ATGGAAAAAA TTATAATTCA TGAGAAATAA ATAGAAGTAC  GGCAAAGTGA TTTGAAACAT AGGTTCATAT TTTGAAAAAT GGGAAGCAAA ATCTATTAAT AGATTTCATA ATATTATAAG ATTCATAATC CTTAAGTTAC TTGCGCATTT TGATTGTTTA  TTATTCTATG AGTTAATGTC AAAGGAACAT CTCCAAAAGT GATCGTAAGT AAGACTTTTG CAGATTCTTC ATCAAAATCA GTGAAGTAAT AACAACTCAT TATAAAAGGC TTGATTATGA  ATCCTTTTCT GGTTTTCTGA AAGTACAGCT GTAAAGCTCC AACAACTATT GAAGGCAGCA GTTCTTTCAA ATATTAGTTA TCATTCACAG AATTGTGACT TATAACTAAA ACTTTAGACT  AACATTTAAA AAACTTATCT AAAAATTTTG CGTATTCCTT GTGACAATTG AGAACTCCTT TCACAATCTC ATATATATGA AATTTCCCTT GATTAAACGT GGGAATCTAA ATGCATTAAT  CATTATAGAT GTTGGCTTAT AAATTTAATT TTGAGATTGA AATGTGGCCA TATCATGTTT TAGTGTATTC ATTTTATAAA AGAAAGAAAC AAAAAAAAAA AATCTTGATT TTCTTGACCA 
CCGATTTCGT CTCACGCAAA ATCCTGTATA AATTATAAAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAGCTCTTCTTCTACTTGTGATGGTTTCTTCATCATCAGCCTTATTGTTATCGTTTCTTCATTGTTTGGGACATCATCTGCGCAGTTAAACGCAACGTTTTACTCAGGC
ACATGCCCTAACGCCTCTGCCATCGTTCGCAGCACTATTCAGCAAGCTCTTCAATCCGATGCAAGAATCGGAGGCAGCCTAATCCGCCTTCATTTTCACGACTGTTTTGTTAAT
GTATAA
TAAGCTTCTTGGTTTTTATATTTTATCATAAATCCTTCTAAATTTTGTTACACTAAACCGCTACTTTGCTTTTTTACATCGGAAAAGGGTTGCGATGGGTCGCTCTTGCTTGACGACACT
TCAAGCATCCAGAGCGAGAAGAACGCTCCTGCCAATGCAAACTCAACTAGAGGATTCAATGTTGTCGATAGTATCAAGACAGCCCTCGAGAATGCTTGTCCGGGCATTGTTTCTTGCTCT
GACATTTTAGCTCTTGCCTCAGAGGCCTCTGTGTCTTTG
GTAATACATAACACTTTCTTCATAAAACATAATCAAACAAAAGAAATTACGATACCTAAAGGCCGACCTTGAGCTCTGTGG
ACCTATCTATGGGCTGGGCCGCCAGTGAAAAATACCTAATATTACCTAATAAGCATGTTTAATTATCTTCTTCAGGCAGGAGGACCTTCATGGACTGTGTTATTAGGAAGAAGAGATGGT
CTCACCGCAAACTTGTCTGGAGCCAATTCGTCTCTTCCCTCTCCCTTCGAAGGCCTTAACAACATCACATCAAAATTTGTAGCTGTCGGGCTAAAGACAACCGATGTAGTATCCTTGTCT
G
GTAAATCATCAGACATGTTTAATTACTTGCAGCTCACTTCAAACAAAACCCTAATTAATGACAACTCTGTTGTTGTTCAATATGCATAGGAGCGCATACGTTTGGGCGTGGTCAATGCG
TAACGTTCAACAATAGACTATTCAACTTCAACGGGACAGGAAACCCCGACCCGACTCTGAACTCAACACTTCTCAGCAGTCTTCAACAGCTATGTCCTCAAAACGGCAGCAATACAGGGA
TCACCAATCTCGATCTGAGCACACCTGATGCGTTCGATAACAATTACTTCACGAACCTTCAGAGTAACAATGGGCTTCTCCAGTCAGACCAGGAACTGTTCTCAAACACCGGTTCAGCCA
CCGTCCCGATTGTTAATTCCTTTGCAAGTAACCAGACCCTGTTTTTTGAGGCGTTTGTTCAGTCTATGATCAAGATGGGGAACATTAGTCCCTTGACTGGGAGTAGTGGAGAGATTAGAC
AAGACTGTAAGGTGGTTAATGGACAGTCATCAGCCACTGAAGCAGGGGACATTCAGTTACAATCTGACGGACCAGTGAGTGTAGCAGATATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAGCTCTTCTTCTACTTGTGATGGTTTCTTCATCATCAGCCTTATTGTTATCGTTTCTTCATTGTTTGGGACATCATCTGCGCAGTTAAACGCAACGTTTTACTCAGGC
ACATGCCCTAACGCCTCTGCCATCGTTCGCAGCACTATTCAGCAAGCTCTTCAATCCGATGCAAGAATCGGAGGCAGCCTAATCCGCCTTCATTTTCACGACTGTTTTGTTAAT
GGTTGC
GATGGGTCGCTCTTGCTTGACGACACTTCAAGCATCCAGAGCGAGAAGAACGCTCCTGCCAATGCAAACTCAACTAGAGGATTCAATGTTGTCGATAGTATCAAGACAGCCCTCGAGAAT
GCTTGTCCGGGCATTGTTTCTTGCTCTGACATTTTAGCTCTTGCCTCAGAGGCCTCTGTGTCTTTG
GCAGGAGGACCTTCATGGACTGTGTTATTAGGAAGAAGAGATGGTCTCACCGCA
AACTTGTCTGGAGCCAATTCGTCTCTTCCCTCTCCCTTCGAAGGCCTTAACAACATCACATCAAAATTTGTAGCTGTCGGGCTAAAGACAACCGATGTAGTATCCTTGTCTG
GAGCGCAT
ACGTTTGGGCGTGGTCAATGCGTAACGTTCAACAATAGACTATTCAACTTCAACGGGACAGGAAACCCCGACCCGACTCTGAACTCAACACTTCTCAGCAGTCTTCAACAGCTATGTCCT
CAAAACGGCAGCAATACAGGGATCACCAATCTCGATCTGAGCACACCTGATGCGTTCGATAACAATTACTTCACGAACCTTCAGAGTAACAATGGGCTTCTCCAGTCAGACCAGGAACTG
TTCTCAAACACCGGTTCAGCCACCGTCCCGATTGTTAATTCCTTTGCAAGTAACCAGACCCTGTTTTTTGAGGCGTTTGTTCAGTCTATGATCAAGATGGGGAACATTAGTCCCTTGACT
GGGAGTAGTGGAGAGATTAGACAAGACTGTAAGGTGGTTAATGGACAGTCATCAGCCACTGAAGCAGGGGACATTCAGTTACAATCTGACGGACCAGTGAGTGTAGCAGATATGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGAATCAATC AGTAAAACGA AAAGCTAATC CAAAACTCTT TAATTATTTG CAACAACTGA TCAATGGCTG TAACAAGCTC TTCTTCTACT TGTGATGGTT TCTTCATCAT CAGCCTTATT  GTTATCGTTT CTTCATTGTT TGGGACATCA TCTGCGCAGT TAAACGCAAC GTTTTACTCA GGCACATGCC CTAACGCCTC TGCCATCGTT CGCAGCACTA TTCAGCAAGC TCTTCAATCC  GATGCAAGAA TCGGAGGCAG CCTAATCCGC CTTCATTTTC ACGACTGTTT TGTTAATGGT TGCGATGGGT CGCTCTTGCT TGACGACACT TCAAGCATCC AGAGCGAGAA GAACGCTCCT  GCCAATGCAA ACTCAACTAG AGGATTCAAT GTTGTCGATA GTATCAAGAC AGCCCTCGAG AATGCTTGTC CGGGCATTGT TTCTTGCTCT GACATTTTAG CTCTTGCCTC AGAGGCCTCT  GTGTCTTTGG CAGGAGGACC TTCATGGACT GTGTTATTAG GAAGAAGAGA TGGTCTCACC GCAAACTTGT CTGGAGCCAA TTCGTCTCTT CCCTCTCCCT TCGAAGGCCT TAACAACATC  ACATCAAAAT TTGTAGCTGT CGGGCTAAAG ACAACCGATG TAGTATCCTT GTCTGGAGCG CATACGTTTG GGCGTGGTCA ATGCGTAACG TTCAACAATA GACTATTCAA CTTCAACGGG  ACAGGAAACC CCGACCCGAC TCTGAACTCA ACACTTCTCA GCAGTCTTCA ACAGCTATGT CCTCAAAACG GCAGCAATAC AGGGATCACC AATCTCGATC TGAGCACACC TGATGCGTTC  GATAACAATT ACTTCACGAA CCTTCAGAGT AACAATGGGC TTCTCCAGTC AGACCAGGAA CTGTTCTCAA ACACCGGTTC AGCCACCGTC CCGATTGTTA ATTCCTTTGC AAGTAACCAG  ACCCTGTTTT TTGAGGCGTT TGTTCAGTCT ATGATCAAGA TGGGGAACAT TAGTCCCTTG ACTGGGAGTA GTGGAGAGAT TAGACAAGAC TGTAAGGTGG TTAATGGACA GTCATCAGCC  ACTGAAGCAG GGGACATTCA GTTACAATCT GACGGACCAG TGAGTGTAGC AGATATGTGA ACAACGATGA GATCAGTTTC ACCGTTTGTT TATCATATAT GAATAATAAC TCCTAGGCCG  AATCATTTTT GTGAAAAAAA TAAGTTTGGT TGAGGAGAAA ATAAGTGAGT GGTAGGGTTG TGTTTTACAC TTTTGAAAAT TTTAATATTC TAAAACATTA TTATGCCTAA ATACATGCAT 
GCATGTATAA CGTCTATCGT TTTGATACAT TTTGTGGATT TGAATCTAAA TTGTGTCACA ACGACAAAAT TT 

Retrieve as FASTA