Entry information : AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Entry ID 221
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-02-06 (Christophe Dunand)
Peroxidase information: AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Name (synonym) AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Mixed tissues
Siliques
Inducer Methyl jasmonate treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx55
start..stop
S start..stop
AlyPrx55 615 0 1..330 1..330
BstrPrx41 607 0 1..330 7..336
CrubPrx70 561 0 1..330 1..335
CagraPrx38 545 0 1..330 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4559798..4560028 231 N° 2 4559510..4559701 192 N° 3 4558862..4559431 570  
complement(join(4558862..4559431,4559510..4559701,4559798..4560028))


exon

Literature and cross-references AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Protein ref. UniProtKB:   Q96509
DNA ref. Phytozome 11:   Chr5 (4560028..4558862)
mRNA ref. GenBank:   NM_121417.4
Cluster/Prediction ref. Phytozome Gene 11:   19671780 UniGene:   At.70997
Omic ref. AtProteome:   At5g14130 ATTED-II:   At5g14130 e-FP Browser:   At5g14130 ePlant:   At5g14130 Genevestigator:   At5g14130 TAIR:   At5g14130
Protein sequence: AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (300)
PWM (Da):   %s   35721.53 (32274.9)  
PI (pH):   %s   4.66 (4.69) Peptide Signal:   %s   cut: 31 range:31-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDIRSDDAKKPMMMWFLGMLLFSMVAESNAQLSENYYASTCPSVELIVKQAVTTKFKQTVTTAPATLRMFFHDCFVEGCDASVFIASENEDAEKDADDNKSLAGDGFDTVIKAKTAVESQCPGVVSCADILALAARDVVVLVGGPEFKVELGRRDGLVSKASRVTGKLPEPGLDVRGLVQIFASNGLSLTDMIALSGAHTIGSSHCNRFANRLHNFSTFMPVDPTMDPVYAQQLIQACSDPNPDAVVDIDLTSRDTFDNSYYQNLVARKGLFTSDQALFNDLSSQATVVRFANNAEEFYSAFSSAMRNLGRVGVKVGNQGEIRRDCSAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 2), 6 cDNA and 5 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCCAAATTG ACAAAGCAGA CCTAATTACA AGACTTCTTC AAAATGAAAA ATTCGCTGTT ACAGAATAAC CAAACAGATC GAAAGCAACC GAACAGTTAT CATCACTAAG AAAATGAATT  CCCCAAAAAT CGTTTCTGGA TACTACCACA AAGAAATAAT TCGACCTCAA AATCTCAGAA CCGCTTCGAT TTGAGCTATG CTAACACGAA TATCATCATC AAGTATTCAA GTGGACCATT  AACGAGAGTG TCTAGACAAG AAACCGATTT TACTGAAAAT TGATCATGTA GATTGTTTAT TCCCTAAGAA AAGCATTACG TCAGATTCGA TCGATTCAGA TTCCATAAGG AGTACCTGTT  TAGCAAGTAG CTCGCGCTCG ACATTTCCAG ATGCAAAGAA CGGCGAATCC GGAGGAAATC TTCGTCGGAT TGGGTTCCAG TACGGAAAGC CTAACTCGCC TACCGTATCT ACCGCCATAC  CCGTAGCCAT CGCTTCCGGC ACTGAGCAGA GCAGAAGAAA TTCAAAATTT TCCGTTTACG TCTCACAAAC ATGAAACAAG TATCCAACTG AACATTTCCT CCGCTCCGGT TTATTAACTG  GATCCTTCCT GGACTATATG ATATCTTGTT CGGCCCAAAG AAGGCCCACG TATAAGAAAC ACCATTTTCT TTTTCTTTTA TATCTAGAAA TTCAAGCCCA AAAATCTTAT ATTTTCCAAA  AACGGGATTC ACACCAGATT AAATTTATCT TCTTTGGAGA AAAAATCCTT TCCAACATGT TTCGAACCTA GCACCTTCAC TTGAGAGATT TACCACTACC TCATTGGTTA ACACCACTAT  ATTTTTAAAC TCGAGTTTCT TAACAAAACT CATTATGTTT CTATCAGTTG ATTAAGAAAT GAAGAGAGAA AAAATTCTGA ATTTTTATTT TTTATTAATT AAATCAGATA GCTAGAATGT  TGATCATGTA ATATGGATTC AAACATTTTC TAAATCAATC CAGATTGAAC TTTTTTCTTT AATCAACTTT ATGGTGGTGT ATATAGTTAA TTAAAAACAT TTTCTATATT TCTATATACC  AAAGTAATTT GGTTAAGCTC TAATGTGTTT GTCACTTCGT AGTTTGTACA CGTGCTGATA TAATTATATA TTGGTCACCT GCAATGAGCT TATAAATAGT TTTCTAATTT GTGGTTGAAA  TTGAAATGAT CTAGAAATCT TCTCACTAAC ATTATATGAT TCTTTTGTAG AAAATAACAC TTTAGTCATC AGCAATTTGA ATATTTGCTA AGTTTCTATT ATCATCAAAA GGGGAACTAG  TCCTGTGATA TGATAAATTT ATACTATTAT AATTTATACC AAAAGATATC TGTATCAGAA AATAACCAAA ATTGGGTAAT ATTAAATGTT AAATTTGAAT TTCGGCTACA ATAGAGGAAC  CGTTGAGCTA AAGTTGATGA ACTAAATTAG AACAGGTATT CCGCTGAATT CATGGCGATC AGTCAAAATC ATTATCATAT TAGGATGGAC AAAGACTAAT TTTCAAACTC ATCTTTTGAA  TTTAATTTAT CCATTTTGTG TTTAACGACA CTATATTATA CGTTTCATCA AGACAAAGTA TTTTAAAATA TCAGAAAAAA ATTCCATGCA GATGACTGAC TTAATGAGGT TTGTTAAACT  GTCACTGTCA GTTAAACCCC CTAACTCAAG AAATGTGTAC TCGCTTAAGT AAAATTTGAG AAATCCTTGT TGTAAAATTC TGGCATTCAC CTGTGAATGT GATTAGATTT TAATCATCAA  ATAACTTATT CATTAACAAA AAATTAAAAT ATAAGCACAT TTATACTATA GAGACTAGAT CCAGTGGCTA TAGATAAATG AGGTGGCATA TCGGAGGGTC AAAACAGATT GGTGTGGTCC 
TATTTATTCA AGAAAGGACT GTATCGACAG AAGAAGGGTT TAAAGAAGAC AAAGAAATTA AAGGAGAAAA ATCGATCACG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTTATTGAA CAAATGTCTA TAACCTAAAA CATATAAATT ATGAAGCTTT TGATTTAAGC TTTTGCTATA CTAAAATGTC ATAATCCACA ATGGAACTTC TCAAATTGTA GGGGTTGACC  TATTTTTCAG GATTATTCAG ATTCCAAAAC ATTATTTGAA AACAAGCAGA AATTTATTTC ATATATGCGA CTGTCTAAAG ATCTTTGTGT AAGTCTACTC ATGGTAGATG TTGCCGTGGA  TATGAATACA AAAAACATAC AAATCAATTA CAAAATTGAC AACAACAACA AAATCGATAC AGAAACAAAC AAAAAAATCG ATACAGAGAC GAAAACATCT GGATCGTAGA ATTGAAGACA  AAAACCAAAG AATAAGAAGC TGAGCACGAT CATATATAAA AGGGAACAGA GATCTTAGGT GCGGGTCTTG CCATAGAGAT GAGTGTAGAC AGACTTGGTA CGACGCACAA GAATCATACT  CAACATGCAA GCGATGATGC AGAATCCAGA CATTATGAGT GATGTCAAGA AGAAACAGAT AGAACCATTG CATCTAAGGG CGTCATCTGG ATCAAACACG GAGCCGTGAG CTTGCCTTTC  TGCTTCCCGG TCGTATATGC TACTCGCGAT CATACCCGAG AACACGAGGG ATCCAGCCGG GTTTGCCAAT GTCAGGAAAT TGTATAACGC TCCAAACTTC TTTAGACCAA AGAGCTCAGA  GGCAGTAGCT GGGACAATAG CCCAGTGTGC ACCGTATCCG AGTCCAATCA ACAGCGTGCC AATGTACATC GCTCCGGGCC ATCCGTACGC AAAGAATATG TGTCCCACAG ACATTATTAG  CTGAGCCACA GCCATTGCTA CTGGTCTTGG ATACGCGTAG TCCCTGCACA TCATTCAAAT CAAGATCAGA ACAGAGCACA AAACAGAGGA TTTTTGGCTT TCTGAGATAT CAAACCTGAC 
AACGAGCTCG GAGAAATAAC CGCCACCGAT CCGTCCAAGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATATTCGTAGTGATGATGCAAAAAAACCTATGATGATGTGGTTCTTAGGGATGCTGTTGTTTTCCATGGTGGCCGAGTCAAATGCTCAACTGTCAGAGAATTACTACGCCTCGACA
TGTCCTAGCGTAGAGCTCATCGTTAAGCAGGCGGTTACTACAAAATTCAAACAAACTGTCACAACGGCTCCTGCAACGTTGCGGATGTTCTTTCACGACTGCTTCGTCGAG
GTATATGTA
CAAACAATGGATGCTAGCTTTTGTAGAATTTTAGAGTTTTATGGAGTCTTTTGGTATTTGTCAATAATTTTGGTGTTTTTTTTATAGGGATGTGATGCGTCTGTGTTTATAGCATCTGAG
AATGAAGACGCAGAGAAAGACGCAGATGACAATAAATCTCTCGCCGGAGACGGATTTGACACCGTGATTAAAGCTAAAACCGCTGTAGAATCTCAATGTCCCGGAGTTGTGTCATGTGCC
GATATACTAGCTCTCGCCGCTAGAGACGTCGTCGTGCTC
GTAAGTCCACTTTCTGAAGTCACCGACGTTTCATTTGATTTCTCCAAGTATAAATCATTTACTTTGTGATGATAACAGGTT
GGAGGGCCAGAGTTTAAGGTGGAGCTAGGGAGACGAGACGGGCTCGTGTCGAAAGCGTCTAGAGTGACCGGCAAGTTACCTGAACCAGGGCTTGACGTGAGAGGTCTAGTCCAGATCTTC
GCTAGTAACGGGCTTTCATTGACCGACATGATCGCTCTTTCAGGCGCACATACAATTGGATCCTCTCACTGCAACCGTTTCGCCAACCGTCTCCACAATTTCTCGACGTTCATGCCAGTG
GACCCTACGATGGACCCGGTCTACGCTCAGCAGCTGATACAAGCCTGCTCTGACCCCAACCCAGATGCTGTAGTAGACATTGACCTAACGTCCAGAGATACCTTCGACAATAGCTACTAC
CAGAACCTCGTGGCTCGGAAAGGACTTTTCACCTCCGATCAAGCTCTGTTTAACGATCTCTCGTCTCAGGCTACGGTGGTCAGGTTTGCTAACAACGCTGAAGAATTCTACAGCGCTTTT
AGCTCTGCTATGAGGAATCTTGGCCGCGTTGGGGTTAAGGTTGGGAATCAAGGCGAGATTCGAAGGGACTGCTCTGCTTTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATATTCGTAGTGATGATGCAAAAAAACCTATGATGATGTGGTTCTTAGGGATGCTGTTGTTTTCCATGGTGGCCGAGTCAAATGCTCAACTGTCAGAGAATTACTACGCCTCGACA
TGTCCTAGCGTAGAGCTCATCGTTAAGCAGGCGGTTACTACAAAATTCAAACAAACTGTCACAACGGCTCCTGCAACGTTGCGGATGTTCTTTCACGACTGCTTCGTCGAG
GGATGTGAT
GCGTCTGTGTTTATAGCATCTGAGAATGAAGACGCAGAGAAAGACGCAGATGACAATAAATCTCTCGCCGGAGACGGATTTGACACCGTGATTAAAGCTAAAACCGCTGTAGAATCTCAA
TGTCCCGGAGTTGTGTCATGTGCCGATATACTAGCTCTCGCCGCTAGAGACGTCGTCGTGCTC
GTTGGAGGGCCAGAGTTTAAGGTGGAGCTAGGGAGACGAGACGGGCTCGTGTCGAAA
GCGTCTAGAGTGACCGGCAAGTTACCTGAACCAGGGCTTGACGTGAGAGGTCTAGTCCAGATCTTCGCTAGTAACGGGCTTTCATTGACCGACATGATCGCTCTTTCAGGCGCACATACA
ATTGGATCCTCTCACTGCAACCGTTTCGCCAACCGTCTCCACAATTTCTCGACGTTCATGCCAGTGGACCCTACGATGGACCCGGTCTACGCTCAGCAGCTGATACAAGCCTGCTCTGAC
CCCAACCCAGATGCTGTAGTAGACATTGACCTAACGTCCAGAGATACCTTCGACAATAGCTACTACCAGAACCTCGTGGCTCGGAAAGGACTTTTCACCTCCGATCAAGCTCTGTTTAAC
GATCTCTCGTCTCAGGCTACGGTGGTCAGGTTTGCTAACAACGCTGAAGAATTCTACAGCGCTTTTAGCTCTGCTATGAGGAATCTTGGCCGCGTTGGGGTTAAGGTTGGGAATCAAGGC
GAGATTCGAAGGGACTGCTCTGCTTTTAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAGAAGACA AAGAAATTAA AGGAGAAAAA TCGATCACGA TGGATATTCG TAGTGATGAT GCAAAAAAAC CTATGATGAT GTGGTTCTTA GGGATGCTGT TGTTTTCCAT GGTGGCCGAG  TCAAATGCTC AACTGTCAGA GAATTACTAC GCCTCGACAT GTCCTAGCGT AGAGCTCATC GTTAAGCAGG CGGTTACTAC AAAATTCAAA CAAACTGTCA CAACGGCTCC TGCAACGTTG  CGGATGTTCT TTCACGACTG CTTCGTCGAG GGATGTGATG CGTCTGTGTT TATAGCATCT GAGAATGAAG ACGCAGAGAA AGACGCAGAT GACAATAAAT CTCTCGCCGG AGACGGATTT  GACACCGTGA TTAAAGCTAA AACCGCTGTA GAATCTCAAT GTCCCGGAGT TGTGTCATGT GCCGATATAC TAGCTCTCGC CGCTAGAGAC GTCGTCGTGC TCGTTGGAGG GCCAGAGTTT  AAGGTGGAGC TAGGGAGACG AGACGGGCTC GTGTCGAAAG CGTCTAGAGT GACCGGCAAG TTACCTGAAC CAGGGCTTGA CGTGAGAGGT CTAGTCCAGA TCTTCGCTAG TAACGGGCTT  TCATTGACCG ACATGATCGC TCTTTCAGGC GCACATACAA TTGGATCCTC TCACTGCAAC CGTTTCGCCA ACCGTCTCCA CAATTTCTCG ACGTTCATGC CAGTGGACCC TACGATGGAC  CCGGTCTACG CTCAGCAGCT GATACAAGCC TGCTCTGACC CCAACCCAGA TGCTGTAGTA GACATTGACC TAACGTCCAG AGATACCTTC GACAATAGCT ACTACCAGAA CCTCGTGGCT  CGGAAAGGAC TTTTCACCTC CGATCAAGCT CTGTTTAACG ATCTCTCGTC TCAGGCTACG GTGGTCAGGT TTGCTAACAA CGCTGAAGAA TTCTACAGCG CTTTTAGCTC TGCTATGAGG  AATCTTGGCC GCGTTGGGGT TAAGGTTGGG AATCAAGGCG AGATTCGAAG GGACTGCTCT GCTTTTAACT AGCTTTATTG AACAAATGTC TATAACCTAA AACATATAAA TTATGAAGCT 
TTTGATTTAA GCTTTTGCTA TACTAAAATG TCATAATCCA CAATGGAACT TCTCAAATTG TAGGGGTTGA CCTATTTTTC AGGATTATTC AGATTCCAAA ACATTATTTG 

Retrieve as FASTA