Entry information : AtPrx56 (At5g15180 / PER56 / AtperoxP56 / ATP33)
Entry ID 222
Creation 2006-01-26 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx56 (At5g15180 / PER56 / AtperoxP56 / ATP33)
Name (synonym) AtPrx56 (At5g15180 / PER56 / AtperoxP56 / ATP33)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Roots
Siliques
Whole seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx56
start..stop
S start..stop
AlyPrx56-1 632 0 1..329 1..329
BstrPrx35 630 0 1..329 1..329
AhalPrx41 626 0 1..329 1..327
CrubPrx46 604 0 1..329 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4930561..4930791 231 N° 2 4930876..4931061 186 N° 3 4931385..4931550 166 N° 4 4931805..4932211 407
join(4930561..4930791,4930876..4931061,4931385..4931550,4931805..4932211)


exon

Literature and cross-references AtPrx56 (At5g15180 / PER56 / AtperoxP56 / ATP33)
Protein ref. UniProtKB:   Q9LXG3
DNA ref. Phytozome 11:   Chr5 (4930561..4932211)
mRNA ref. GenBank:   NM_121522
Cluster/Prediction ref. Phytozome Gene 11:   19669260 UniGene:   At.43105
Omic ref. AtProteome:   At5g15180 ATTED-II:   At5g15180 e-FP Browser:   At5g15180 ePlant:   At5g15180 Genevestigator:   At5g15180 TAIR:   At5g15180
Protein sequence: AtPrx56 (At5g15180 / PER56 / AtperoxP56 / ATP33)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (298)
PWM (Da):   %s   36087.58 (32696.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.54 (8.56) Peptide Signal:   %s   cut: 32 range:32-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALKMTISCFLFLQVIYCLLSSFAPTNVQGLKVGFYDKACPKAELIVKKSVFEAVKNDRTIAAPLLRMFFHDCFVRGCEGSVLLELKNKKDEKNSIPNLTLRGFEIIDNVKAALEKECPGIVSCSDVLALVARDAMVALNGPSWEVETGRRDGLVTNITEALLNLPSPFNNISSLITQFQSKGLDKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYAVKLRGKCKPTDTTTALEMDPGSFKTFDESYFKLVSQRRGLFQSDAALLDNQETKSYVLKSLNSDGSTFFKDFGVSMVKMGRIGVLTGQVGEVRKKCRMVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns), 4 cDNA and 7 ESTs (4 only in roots).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACATCATT AATGGAAACA CAAGAAGTAT TAGCCCAATC AGGCAATGCA TCAACACTCA AAAGCCGAAA TGTTGAAGGT AGTTTCTCAT TAGGTGGACA AAAACGACGA ATGGCCTCTA  CATCGTCTTC AGCCTAAAAC AGTTCCATCA CATCAAACAA AGCCTCAAAG AAACAACAAA AAAAGCAACA TTCTTTGGTT AAGCCAAATA AGTTACCTTT CGAGCTTTCT TAGCAGCTCT  TCCATTGAGC AAAACTAGCT TGAAGAAATG GTGACCAGGG ATCAATTCAA TAAGATCATC ATTACATACT GAAACCTCTT CACTAGGTTT CACTTTCTTT CTCTCTCCGT CACCGGAAGA  CCTAATAACA ACCGGATTTG TTCCGTCCTA CCCAAAAGAC ACAAACTTGA CATGATTCAA TTCGATAAGA AGCCAAAGTT ATAATTTTTA ATGTTGTTAT AGTTATTACC ACTGACAACG  AAGCTGAGCC AGAAGTGGAA ACGATAATGG TGATGTGTTT GCGACTGAGA CGCTTATCGA CGATTGAAAC GTTGCCACGG CCAATGATGT TTGGACCTTC GGATAAAGTT ATCCTTGGAG  ATGAATTGTC TTCCTTTAAA TCTGCTTTCA ATGGAATCAA ATAAGCAACC TGCAACAGAT ACATAAATCA GAGCAAGACA TCGAATTTTC TGTAATTGGA AGAAACGGAA ATTAGGGTTT  TGTTTTGAAT TACCTGAGAG TGAGCCATTA AGGAAGACAA GTGTCTGAGG TTGAATTGAA CCAAGGAAGA AGAAGAAGAT GCAAAACGCT GCGTTTCAGT GAACTAACTA GCGAAAATTT  TGGGATGTTT CAATGGAGAA TAATGGGCAA GAAATTCATA GTAACGGTAA CGGTTCTCCA CGCCGGCGGC GACAATCAGA CAACCGCATC ATCATCAGCC GATGGGTCTT TGGCTTGTGA  AGTTGTACAA TATATTAATT TAAGAAACAT TGTCATCAAA GTCTGGGTGG TGTAGTCGGT TATCACGCTA GTCTCACACA CTAGAGGTCC CCGGTTCGAA CCCGGGCTCA GACATTTTTT  TTTCTTCATT TTTTTCAATT GACACGTGTC CGAACCTTGC CCAAAAATAA TAGTATGATT AACATATTTT ATCTTCCCAT TACGTTGAAA TGTTACAATC GAATATTCGA ATGAGTGTGA  TTGGAATTGG ATGAACATGC AGATTGTTAC GTGGACAAAA TAATTGTGAT CAAGTCCAAA GATTAAACAA TGTAGTTTAA CTCCAAAGAG TTTGTAAGAT AAAGGATATT GATTATATTA  TGTTAATCAA ATTTTTAAGA TGTATTATTT TGTTCTCCTA CCGTATTATT GTCACTTTTC AGTTGCGAAG TCAAATGTCA CAAGCAATAT TGTTCATTGT TAATCCTCCT ACCTACCAGT  CATTGTCTAC GTGTAAATTA GATAGCTATG GACGGCTTGT GTTCCATTCT AATTGTTATA CGTATAATAT AGTTTTTTCT TGTGGTTTAC TTGTCGATTT CAAGTTAGTT ATCGACAAAT  TACCATTATT CGTTATCAAG TGTTTTCTTA TTCGTTACAA CACCTAGTTG ACGAAAAGAT CTGAATATTG CCAAATTTCA AAAACTTATT AAGTTTGTGT TGGTTATTTT TTTCATTGTT  TAAAATCATT GGCACCCTTT TTCTGGTGTA AATAGTAATA AACATCAACG AAGACGATAA GCCATAAACA AAGGACAGCT ATATATATTC CACAAACAAC AATATAAAAT TCAACAAATT  TACAAAAAAT TCCTATATCT TTGTCTTTAA AATTCAATGA TGTAACCACG AACACTTTGT ATTTTTGTAT TTCAACCTTA AACTATAGTA CTAACAAGTT CCGTGACATT ATTACATAAG 
CACGTTAGTA TAAATAACAA CAACAATATT AACTCAATTA GTATCATCGA TCATCTGTCA AAAAGAGGAG CTAATAATAA T 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTATATTTTA TATAGATATG TCTGTGAGAT TGTTTTATGA TTATGTATGT GTTTTTCCCT AAGAATATTG TGTGGAGTTA TATGTATTGT ACAATGGAAT GTTAAATTGT AAAATATGTC  ATGTTTTATT TATCACAAAA GAAAAAATTC GATTACGATT TTATTTCTTA ATATATAGTT TATATTTTGC TTTAATATAT ATTTCTTTTT TGTTTTGGGC TTATCTGATC TACACTCACT  ATATACATTA AATATATCAA GATTAAAAAT TGTAGTTTTT GGAAATTCAA TAGATTTTAA AAAGCATCCT AAATTACCTT TCCATTTTGT AGTAAACAAT TTTGTTGGCT TATATCATTT  AGTGGCAAAC CATCAGTAAA GTTTAAACTT TACAAGGACT ATGATATTTT TGACTCGTAA ATTAGTTTTT ATTAGTCGAT CTTATCTTCA ATGTCACAAG TATTTATTAA GAATTAAAAC  TCTAATGAGG TGGCAATAAT TATGGATTTT TAATGTTATG AGTCTACATC ATTTCAAATT TGTGCCATAT ACAAATACAC ATGTGTATGT ATGTAGTTTG CTAAATGATA CATAGAGAGT  GGTCATATAA GGTAAACAAA AAGTGGAGCA TAAAGTTTCA TAAGCTCATA TATACAGATT CACGGTTTAT ATACACATGA CTTTTATCAC CATAAAAAAC AAAAAAAGCT TTCTCTCACT  CTCTAAACAA GGATCTTCCA AAAACAAAAC GAAACGAAAC AACAATAAAA AAAAGTTCAA AGCAACCAAA AAAAAACAGA GAAATTGAAA GAAGACATAT CACCTGCACA AACTAGTGTA  AATGAGATCA AATTCATATA AGTTTAGTGT AATTTGTTGG ATCGATATAT ACATCGAGAA ACAAACCTTG ATCGATTTTG GATCTGTGAA TCATCATCAC TGAGTCTGAA CAACGTTAAC 
GGATCTCCCT TTTCCACTAA GTGGCGAACA AGGCAAATTC T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTGAAGATGACTATCTCTTGTTTCTTGTTTCTTCAAGTAATATATTGCTTGCTCTCTTCATTTGCTCCAACAAATGTGCAAGGATTGAAAGTTGGATTCTACGACAAGGCA
TGCCCCAAAGCCGAGCTTATTGTCAAAAAGTCTGTCTTCGAGGCTGTGAAGAATGATCGGACAATTGCAGCTCCTTTGCTCAGGATGTTCTTCCACGATTGCTTCGTTAGG
GTAATGTCC
TTTCTTGACATCCTGAATTTTCCTTTTAGTCTTTTTGACACCTTGTGATCTAATGATTGAATCATGATGTTTTAGGGATGCGAAGGGTCGGTATTGCTAGAGCTAAAGAACAAAAAAGAT
GAGAAAAACTCAATTCCTAACCTCACCCTTCGAGGATTTGAGATCATAGACAATGTCAAGGCAGCTCTAGAAAAGGAGTGTCCGGGCATTGTTTCTTGCTCTGATGTATTGGCTCTTGTC
GCTAGAGACGCAATGGTTGCG
GTAAGTATAAATTCTTACTATCATGTGATCTAATATTTGGTCAGAGCTCACGGTGTCTTTATTACACGCTCCTTGTATTTATTACTACAAAGTTCACAT
GGCGATTATAGACATCATAAATAGGGTTGGGCGTATTCTTCTATTTTTTTGATGCTACAAAATGCACTTGACTTAAATTTTCAAGAGACTAGTTCAGCTTTCTATCTGAGATTTTCTGAC
TAATATATTAAAGAAAATATATCCATAAAAAAAATTATGTATTATATGTTGTGTTGAACTTTTAACATCATGTATTTTATGATAACCAATCAATATATGTTCAGCTCAATGGACCGTCGT
GGGAGGTTGAAACGGGACGAAGAGACGGTCTGGTTACAAACATCACTGAGGCCTTATTAAACTTACCATCACCATTTAATAATATCAGTAGCCTTATCACTCAATTCCAGTCCAAAGGCC
TCGACAAGAAAGACCTCGTTGTGCTTTCAG
GTATGTTATGGAATCAGAAAATTCTTTAAATTATACTTGAACGATGCATCAAATAATTAAAGGGCAGTGTTCTTTGAACAAATGTTTTTC
TCTTTTTTCCAAGCATTGTTTGGCTATTTTGGACTAGCAACTAACAATAATACTCTTTCTTCTACATATTTTCTATATTACTCTCTGGCTTCGGATCACTAGTTGTAAAATAATAAAAAT
AAAATCATTCTCATATAATTTGTATATTATTTACATTTTGATAGGTGGGCACACAATTGGGAATGGACATTGTCCACAGATCACAAACCGTCTCTACAACTTCACCGGAAAAGGAGATAG
TGACCCGAACTTAGACACGGAATACGCAGTCAAACTCAGAGGAAAATGCAAGCCAACTGATACCACAACGGCTCTAGAAATGGATCCAGGAAGCTTTAAAACGTTCGATGAAAGTTACTT
CAAGCTTGTGTCTCAAAGAAGAGGATTGTTTCAATCTGATGCAGCTCTTTTAGACAATCAAGAAACTAAGTCTTATGTTCTCAAGAGTTTGAATAGTGATGGGTCTACTTTCTTTAAAGA
CTTTGGTGTCTCCATGGTAAAAATGGGTCGGATTGGAGTTTTAACGGGTCAGGTTGGGGAAGTTCGCAAGAAGTGCAGAATGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTGAAGATGACTATCTCTTGTTTCTTGTTTCTTCAAGTAATATATTGCTTGCTCTCTTCATTTGCTCCAACAAATGTGCAAGGATTGAAAGTTGGATTCTACGACAAGGCA
TGCCCCAAAGCCGAGCTTATTGTCAAAAAGTCTGTCTTCGAGGCTGTGAAGAATGATCGGACAATTGCAGCTCCTTTGCTCAGGATGTTCTTCCACGATTGCTTCGTTAGG
GGATGCGAA
GGGTCGGTATTGCTAGAGCTAAAGAACAAAAAAGATGAGAAAAACTCAATTCCTAACCTCACCCTTCGAGGATTTGAGATCATAGACAATGTCAAGGCAGCTCTAGAAAAGGAGTGTCCG
GGCATTGTTTCTTGCTCTGATGTATTGGCTCTTGTCGCTAGAGACGCAATGGTTGCG
CTCAATGGACCGTCGTGGGAGGTTGAAACGGGACGAAGAGACGGTCTGGTTACAAACATCACT
GAGGCCTTATTAAACTTACCATCACCATTTAATAATATCAGTAGCCTTATCACTCAATTCCAGTCCAAAGGCCTCGACAAGAAAGACCTCGTTGTGCTTTCAG
GTGGGCACACAATTGGG
AATGGACATTGTCCACAGATCACAAACCGTCTCTACAACTTCACCGGAAAAGGAGATAGTGACCCGAACTTAGACACGGAATACGCAGTCAAACTCAGAGGAAAATGCAAGCCAACTGAT
ACCACAACGGCTCTAGAAATGGATCCAGGAAGCTTTAAAACGTTCGATGAAAGTTACTTCAAGCTTGTGTCTCAAAGAAGAGGATTGTTTCAATCTGATGCAGCTCTTTTAGACAATCAA
GAAACTAAGTCTTATGTTCTCAAGAGTTTGAATAGTGATGGGTCTACTTTCTTTAAAGACTTTGGTGTCTCCATGGTAAAAATGGGTCGGATTGGAGTTTTAACGGGTCAGGTTGGGGAA
GTTCGCAAGAAGTGCAGAATGGTTAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGTATCATCG ATCATCTGTC AAAAAGAGGA GCTAATAATA ATATGGCTGC TTTGAAGATG ACTATCTCTT GTTTCTTGTT TCTTCAAGTA ATATATTGCT TGCTCTCTTC ATTTGCTCCA  ACAAATGTGC AAGGATTGAA AGTTGGATTC TACGACAAGG CATGCCCCAA AGCCGAGCTT ATTGTCAAAA AGTCTGTCTT CGAGGCTGTG AAGAATGATC GGACAATTGC AGCTCCTTTG  CTCAGGATGT TCTTCCACGA TTGCTTCGTT AGGGGATGCG AAGGGTCGGT ATTGCTAGAG CTAAAGAACA AAAAAGATGA GAAAAACTCA ATTCCTAACC TCACCCTTCG AGGATTTGAG  ATCATAGACA ATGTCAAGGC AGCTCTAGAA AAGGAGTGTC CGGGCATTGT TTCTTGCTCT GATGTATTGG CTCTTGTCGC TAGAGACGCA ATGGTTGCGC TCAATGGACC GTCGTGGGAG  GTTGAAACGG GACGAAGAGA CGGTCTGGTT ACAAACATCA CTGAGGCCTT ATTAAACTTA CCATCACCAT TTAATAATAT CAGTAGCCTT ATCACTCAAT TCCAGTCCAA AGGCCTCGAC  AAGAAAGACC TCGTTGTGCT TTCAGGTGGG CACACAATTG GGAATGGACA TTGTCCACAG ATCACAAACC GTCTCTACAA CTTCACCGGA AAAGGAGATA GTGACCCGAA CTTAGACACG  GAATACGCAG TCAAACTCAG AGGAAAATGC AAGCCAACTG ATACCACAAC GGCTCTAGAA ATGGATCCAG GAAGCTTTAA AACGTTCGAT GAAAGTTACT TCAAGCTTGT GTCTCAAAGA  AGAGGATTGT TTCAATCTGA TGCAGCTCTT TTAGACAATC AAGAAACTAA GTCTTATGTT CTCAAGAGTT TGAATAGTGA TGGGTCTACT TTCTTTAAAG ACTTTGGTGT CTCCATGGTA  AAAATGGGTC GGATTGGAGT TTTAACGGGT CAGGTTGGGG AAGTTCGCAA GAAGTGCAGA ATGGTTAATT AAGTATATTT TATATAGATA TGTCTGTGAG ATTGTTTTAT GATTATGTAT 
GTGTTTTTCC CTAAGAATAT TGTGTGGAGT TATATGTATT GTACAATGGA ATGTTAAATT GTAAAATATG TCATGTTTTA TTTATCACAA AAGAAAAAAT TCGA 

Retrieve as FASTA