Entry information : AtPrx58 (At5g19880 / PER58 / AtperoxP58 / ATP42)
Entry ID 224
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx58 (At5g19880 / PER58 / AtperoxP58 / ATP42)
Name (synonym) AtPrx58 (At5g19880 / PER58 / AtperoxP58 / ATP42)
Class Class III peroxidase    [Orthogroup: Prx073]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx58
start..stop
S start..stop
AlyPrx58 645 0 1..329 1..329
AhalPrx63 622 0 16..329 1..314
BrPrx58-1Aa_other 613 0 1..329 1..330
TsPrx58-1 610 0 1..329 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6722202..6722411 210 N° 2 6721453..6721650 198 N° 3 6721103..6721268 166 N° 4 6720578..6720993 416
complement(join(6720578..6720993,6721103..6721268,6721453..6721650,6722202..6722 411))


exon

Literature and cross-references AtPrx58 (At5g19880 / PER58 / AtperoxP58 / ATP42)
Protein ref. UniProtKB:   P59120
DNA ref. Phytozome 12:   Chr5 (6722411..6720578)
mRNA ref. GenBank:   NM_121995
Cluster/Prediction ref. Phytozome Gene 12:   19668060 UniGene:   At.31241
Omic ref. AtProteome:   At5g19880 ATTED-II:   At5g19880 e-FP Browser:   At5g19880 ePlant:   At5g19880 Genevestigator:   At5g19880 TAIR:   At5g19880
Protein sequence: AtPrx58 (At5g19880 / PER58 / AtperoxP58 / ATP42)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (306)
PWM (Da):   %s   35292.84 (32884.4)  
PI (pH):   %s   4.92 (4.81) Peptide Signal:   %s   cut: 24 range:24-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSKTIPLVLLPILMFGVLSNAQLTSDFYSTTCPNVTAIARGLIERASRNDVRLTAKVMRLHFHDCFVNGCDGSVLLDAAPADGVEGEKEAFQNAGSLDGFEVIDDIKTALENVCPGVVSCADILAIAAEISVALAGGPSLDVLLGRRDGRTAIRADAVAALPLGPDSLEILTSKFSVHNLDTTDLVALSGAHTFGRVQCGVINNRLHNFSGNSGQSDPSIEPEFLQTLRRQCPQGGDLTARANLDPTSPDSFDNDYFKNLQNNRGVIESDQILFSSTGAPTVSLVNRFAENQNEFFTNFARSMIKMGNVRILTGREGEIRRDCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns )3 cDNA and 5 ESTs. Found only in library 10434: RAFL19
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTGGGGAGGT TAGGACAAAC TGCAGGGTTA TCAATAATTA GCATGTGTGT GTGTTTTCGA GTTTATGTAA TGTTTGGGAG TTGATCGGTC TCGTGTGTAT CAGAATGATC ACGTGTGTAA  TAATAAGAAT TAATGGGGTT TGTTGGTTTG CCTAATTAAA AGTGATTTGG TAAACCTGGA AATTTTCATT GATTTTAAAA TTAAACAAGT GTGTTGTAAA CCAAAACATG TGGATTTCAA  ACCAAAAAAA TGGATTCGAA ACTCCTAAAA TTTATGATCA TAATAATGCA AGCACAATAT ATAGAAGCTT CCATTGTTAT TAATTTTGAA ATAGCGTCGT ATGTGATTTT CTTGGATTAA  GAAAAATTAC TTTGTTAGGG TTGTTAAAGG GTTGCTTTGT TAGTTTTTTA AGGATATATA TCCAAAATAT TTACAACCAA GGGGATATGT AGTTGCAGCA CTTCTTTGAT TCTTTCGAAT  AAGAAGATGA AACCAATATT AATCAATCAA TATAATGGAA CAAAATATCG ACCGCCGGTA ATAATTAGCT GAAAGCCTGA AACCAAAATA AGGAAAGGAA AAGAAAAAGT TTTATATACT  TCTAGTTTTT ATGGAACGCA AGGAATCTTT GTGCGCATAT GAAAACGACC CCGTCCAATT GTTTTGAGAC AGCTGACTCC GATTAATCAT TTTTTTTGTC AACAAAACTG ACTCTATTAC  GATGGCTTGA ATACGACAGT TTCAAATTTA CGCGGAAAGG AATAGTAAGC ATTATGCGAT TCCAACAAGT AATTCATAAT TAGTGTTGAC GTAAGTTAGT TTTTGTTTTC TTTAATTAAC  TGATTTTTCA TTAATACTTT TTAATTATAA ACATGAATTT GATTAACTCG ATCGTTTACT TAAAATTCAT TTCAATCAAT TTCAGAGCAA CGACTACAAG TAAAAGACAA TATTTAAAAT  TTGAACTTTG TATACGATCT GAGTTTCTAT CTACTGACTA CTGTATTTGT ATCTGAGGTG AATTAGCTAA ATATGAACAT GAAAATATGT TTATCTAGAT AAGTGACAAA ACAGCTGTTA  TGAAGCATTC ATATATTTAC GTTTCAAAAT GACAGTTACA TATTTGCATG TTAGATATAT ATGCAACAAA ACAAGGTCAA AACACATGTA TTTTTTTACT CATCGATCGA GTATTACGAT  AGTACATACC TAATTTTCTT CAAGTCAATT CTAGCTTTGC TATTTAATTA TTCAACATGC CGTTACGAGC TTCTTTTGTC TTTTTTAATC AGCTGTAGTT ATTTTCTTTC ATCCATGACG  ACATACATTG ACATAAATAT ATATATATAT ATATATATAG ATATACATTT TTAAAATAAC TAGGCTAGTT TGATGATTGG ATTTACAGAA AAACTGTAAT ATATTATTGT ATCTTTGGTT  TAAGAAAAAA ATGTATGTAA TATACATTTT TATATTTGAA CGAATGGATT TTGTAGGTTG CGAAACTTAT AGAGATTGCT CTCAGCCTTT TATATTCTTG AACAATATCC ATTTTTTCTC  AGTTAGACTA CAGTAAATAT TGTGATTAGG AAAAGACACA TATACACACA TGTTTTATGT TCGCTTAGTG GATACTAAAT TTTAGAGTCG TTGTATGTAT AGTTTACAAA TGCAACAAAT  TTTAGTAACT TGCAAATGAA GAATTGATTA ATTTATGACC ACTGATGAAT TTTTCCAAAA CAAAAAGAAG CAAATTTTAG TAACTTAATA GAATGCTTAT CATTATATTA TGATTTTTCG  TGTCCTTCAA AAAGAAAAGT AAAAGTCTAG ACGAATTGAA CTGAAATGTT TTGTATTTTT CCTGGTACAT GTAGAATTTT CTTCAAACAT TAGGTATAAG CTCTCTATAA AAGGCTACGA 
AAGTCTTTCA TTTTAGCATC AACTCCTCTA ATAAGCTTCT TCTTTCTATC CCTCACTTTT ACAAACAAAG GGAGACCAAA A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAGTTTTGC ATGGTTAAAT GATCAAACGT AACTTATTGT TATTCATGAA ATAAGTGTTC TTTAGTTTGT GCTTCTCCAC AATTAATTGT TTTTCTTCTT TTGATTTTAT TTACTGTTAA  GCATGCCATT GTTACTTGTA ATTGTAAATC TTATATAATA TTTTTCTTTT TGAAAAAATC CACTATCATG TCTGAAATTA TTATTAGTCC ACCAATGAGG ATTCAACTCC CACCTATGGT  TCATTAGACT GATTCAACGG CATTACTGTT CTTATATACG GAAGAAAAGA AGAATATATC AATATTATGA GGCATGTCGC TTGACCGATT CAAAAAGGTA AATTTTATTA CCTCCCTCGA  TGAGTTAGTT CGTAATTCCT ATCTAAATTT TTTGAAGATG TCTCGACTCA ATATTCTATA ACTTCCACTT CATTAACGTA TGTTTTTTTT CCCCGGCCAA TGTACCACAC AAGTGATTAG  ATCCAAGTTT AAATAAAATG GGAAACCAAA TGTGAGTCAA GTAGTGGAAA AAAGTCACTG AAATTTTCAT TAAAATTTGT TTTGAATTTC GCATATGTTA AGATCCAATG ACACTTTATT  ACGAATCGAT ACTAGCTACC AAAAGGAATT TTAACTAAAG ATTTACCCTA ACAGCCAATA TCAATTTCCA GCACCAAATA AACCCTGAAA GGACCTGAGA AAAGTGGCGT CAAAGGGCCC  AAAGTTGAGT GTGAACGAGA AGATGGAAAA AGACTCATTT CTTTCATTTA GTATTCGAAT CTAGAGGATA GTTGACTCTC CAATTGTCGT TGCCTCTCTG ATTTTTCAGC TCTTTGATTA  TGATTAATTT AGCCATTTCT ATCATTTAGC AAGGAAGATT TGAAAATTTG GCAAAATTTT AGTGGGACAA TGTCGCTTTC AATCTGGAGT ATTTTATCAG ACTCTAGAAT CTACCCCTAA 
CTTTATAAAC GAGTGGTGGG AATGTAACCA AAACACGTCG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTAAGCAAAACTATTCCCTTAGTGTTACTCCCGATTTTGATGTTTGGGGTTTTGAGTAACGCTCAGCTTACCTCTGATTTTTACTCCACGACATGCCCTAACGTCACAGCCATT
GCTCGGGGACTGATCGAGCGAGCAAGCCGTAACGACGTCAGACTCACTGCTAAAGTCATGCGTCTTCACTTTCATGACTGTTTCGTGAAC
GTAAGATATATTTCTACTCAATACCATATG
TTTGTGATTGGTTTTGGTTTAGTAATGAAACCAATCGTTTAATGTGCATCAGTCCATGTGATCTTATGATTCATCTTGAATCCAAACCAGCATATATTTATGAATGAATATAACTAAACA
TGACTTTACTTTAGGTTTAATGGGGATTAATAATAGTTCATACTCGTTGTTTGACCAAAAAGTGGATTTCAAACAAAAGCAACATTAAAATTAGAGTTTGCATTAGTGGAATCATTTTTC
AAGGACAAATTTGACGTTAATTTCTTTTTGATGTTTGATTATATATATGTTTGACTATAGATTCTGTCTTAATTAATGGTTTCATATGGAGAAAGTAACGGTCTTTCTTAACCCAAATTA
AAATATCTCCTTTTTTTTCCTTCGCTAATCGTTAACTAAGAAAAGTATAGAGTCTTCGTCAAGAAAACATAATTAGGTTTATTTTGTTAGTGGAATTAGGTTTCTTTAATTTGAAAAGTT
AGATATGCATAAAATATTGAAGTCATAGTTTGTGAACACAGGGGTGCGATGGTTCGGTACTATTGGACGCTGCTCCAGCGGATGGGGTAGAGGGTGAAAAGGAGGCTTTCCAAAACGCGG
GTTCTCTTGATGGATTCGAAGTGATCGATGATATCAAAACCGCCCTCGAGAATGTTTGTCCCGGAGTTGTCTCTTGTGCTGATATCCTCGCTATCGCAGCTGAAATCTCTGTTGCACTG
G
TAATAACATCATTCTTTAAATTTATGTGCTTTCAGATACCTTTTTTAACCAATGGAAACATAATCATAACCAAATCTCTGTTACCACAGCATTCAAATTGAGAAAAAATATTATGAAAAC
ATTATAGTAATATACCGTAAAAATTCATACTCTAATGTTTTTATTTATTTGATATCATTTAAGGCGGGAGGGCCGTCATTGGACGTATTGCTAGGAAGGAGAGATGGCCGGACAGCGATC
CGTGCGGACGCAGTGGCTGCACTTCCACTAGGACCTGATTCTCTCGAGATTCTTACTTCCAAATTCTCCGTACATAATCTTGACACTACCGATCTCGTCGCTTTATCTG
GTATTGTACTT
ACGCATCTTAATATTTGTTTAGTTTAATTTTGTCATAGGTCATCTTAGAAATATCTTAAGGTACTATGAATCATAATACATATAATGTACGTATTTAGGTGCTCATACCTTCGGGAGGGT
TCAGTGTGGAGTGATAAACAATCGTCTACACAACTTTAGTGGTAACAGCGGACAGTCCGACCCAAGTATCGAACCGGAGTTCTTGCAAACGTTACGACGACAATGCCCGCAAGGCGGAGA
TCTCACCGCAAGGGCGAATCTTGATCCTACGAGCCCCGACTCATTTGATAACGACTATTTCAAGAACCTTCAAAACAACCGCGGAGTGATTGAATCAGATCAAATCTTGTTCTCTTCGAC
AGGAGCGCCTACTGTGTCTTTGGTGAATCGTTTTGCTGAGAACCAAAATGAGTTCTTTACAAATTTTGCGAGATCAATGATCAAGATGGGAAATGTGAGGATTCTCACAGGACGTGAGGG
AGAGATACGTAGAGACTGCAGACGCGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTAAGCAAAACTATTCCCTTAGTGTTACTCCCGATTTTGATGTTTGGGGTTTTGAGTAACGCTCAGCTTACCTCTGATTTTTACTCCACGACATGCCCTAACGTCACAGCCATT
GCTCGGGGACTGATCGAGCGAGCAAGCCGTAACGACGTCAGACTCACTGCTAAAGTCATGCGTCTTCACTTTCATGACTGTTTCGTGAAC
GGGTGCGATGGTTCGGTACTATTGGACGCT
GCTCCAGCGGATGGGGTAGAGGGTGAAAAGGAGGCTTTCCAAAACGCGGGTTCTCTTGATGGATTCGAAGTGATCGATGATATCAAAACCGCCCTCGAGAATGTTTGTCCCGGAGTTGTC
TCTTGTGCTGATATCCTCGCTATCGCAGCTGAAATCTCTGTTGCACTG
GCGGGAGGGCCGTCATTGGACGTATTGCTAGGAAGGAGAGATGGCCGGACAGCGATCCGTGCGGACGCAGTG
GCTGCACTTCCACTAGGACCTGATTCTCTCGAGATTCTTACTTCCAAATTCTCCGTACATAATCTTGACACTACCGATCTCGTCGCTTTATCTG
GTGCTCATACCTTCGGGAGGGTTCAG
TGTGGAGTGATAAACAATCGTCTACACAACTTTAGTGGTAACAGCGGACAGTCCGACCCAAGTATCGAACCGGAGTTCTTGCAAACGTTACGACGACAATGCCCGCAAGGCGGAGATCTC
ACCGCAAGGGCGAATCTTGATCCTACGAGCCCCGACTCATTTGATAACGACTATTTCAAGAACCTTCAAAACAACCGCGGAGTGATTGAATCAGATCAAATCTTGTTCTCTTCGACAGGA
GCGCCTACTGTGTCTTTGGTGAATCGTTTTGCTGAGAACCAAAATGAGTTCTTTACAAATTTTGCGAGATCAATGATCAAGATGGGAAATGTGAGGATTCTCACAGGACGTGAGGGAGAG
ATACGTAGAGACTGCAGACGCGTCAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCAACTCCT CTAATAAGCT TCTTCTTTCT ATCCCTCACT TTTACAAACA AAGGGAGACC AAAAATGGGT CTAAGCAAAA CTATTCCCTT AGTGTTACTC CCGATTTTGA TGTTTGGGGT  TTTGAGTAAC GCTCAGCTTA CCTCTGATTT TTACTCCACG ACATGCCCTA ACGTCACAGC CATTGCTCGG GGACTGATCG AGCGAGCAAG CCGTAACGAC GTCAGACTCA CTGCTAAAGT  CATGCGTCTT CACTTTCATG ACTGTTTCGT GAACGGGTGC GATGGTTCGG TACTATTGGA CGCTGCTCCA GCGGATGGGG TAGAGGGTGA AAAGGAGGCT TTCCAAAACG CGGGTTCTCT  TGATGGATTC GAAGTGATCG ATGATATCAA AACCGCCCTC GAGAATGTTT GTCCCGGAGT TGTCTCTTGT GCTGATATCC TCGCTATCGC AGCTGAAATC TCTGTTGCAC TGGCGGGAGG  GCCGTCATTG GACGTATTGC TAGGAAGGAG AGATGGCCGG ACAGCGATCC GTGCGGACGC AGTGGCTGCA CTTCCACTAG GACCTGATTC TCTCGAGATT CTTACTTCCA AATTCTCCGT  ACATAATCTT GACACTACCG ATCTCGTCGC TTTATCTGGT GCTCATACCT TCGGGAGGGT TCAGTGTGGA GTGATAAACA ATCGTCTACA CAACTTTAGT GGTAACAGCG GACAGTCCGA  CCCAAGTATC GAACCGGAGT TCTTGCAAAC GTTACGACGA CAATGCCCGC AAGGCGGAGA TCTCACCGCA AGGGCGAATC TTGATCCTAC GAGCCCCGAC TCATTTGATA ACGACTATTT  CAAGAACCTT CAAAACAACC GCGGAGTGAT TGAATCAGAT CAAATCTTGT TCTCTTCGAC AGGAGCGCCT ACTGTGTCTT TGGTGAATCG TTTTGCTGAG AACCAAAATG AGTTCTTTAC  AAATTTTGCG AGATCAATGA TCAAGATGGG AAATGTGAGG ATTCTCACAG GACGTGAGGG AGAGATACGT AGAGACTGCA GACGCGTCAA TTAATAAGTT TTGCATGGTT AAATGATCAA  ACGTAACTTA TTGTTATTCA TGAAATAAGT GTTCTTTAGT TTGTGCTTCT CCACAATTAA TTGTTTTTCT TCTTTTGATT TTATTTACTG TTAAGCATGC CATTGTTACT TGTAATTGTA 
AATCTTATAT AATATTTTTC TTTTTGAAAA AATCCACTAT CATGTCTG 

Retrieve as FASTA