Entry information : AtPrx59 (At5g19890 / PER59 / AtperoxP59 / PeroxidaseN / AtatPN / AtPN)
Entry ID 225
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx59 (At5g19890 / PER59 / AtperoxP59 / PeroxidaseN / AtatPN / AtPN)
Name (synonym) AtPrx59 (At5g19890 / PER59 / AtperoxP59 / PeroxidaseN / AtatPN / AtPN)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Mixed tissues
Roots
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx59
start..stop
S start..stop
AlyPrx59 630 0 1..328 1..328
AhalPrx07 624 0 1..328 1..328
BstrPrx86 616 0 1..328 1..328
AruPrx06 608 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6725653..6725877 225 N° 2 6725344..6725526 183 N° 3 6724872..6725034 163 N° 4 6724372..6724787 416
complement(join(6724372..6724787,6724872..6725034,6725344..6725526,6725653..6725 877))


exon

Literature and cross-references AtPrx59 (At5g19890 / PER59 / AtperoxP59 / PeroxidaseN / AtatPN / AtPN)
Protein ref. UniProtKB:   Q39034
DNA ref. Phytozome 12:   Chr5 (6725877..6724372)
mRNA ref. GenBank:   NM_121996
Cluster/Prediction ref. Phytozome Gene 12:   19667549 UniGene:   At.143
Omic ref. AtProteome:   At5g19890 ATTED-II:   At5g19890 e-FP Browser:   At5g19890 ePlant:   At5g19890 Genevestigator:   At5g19890 TAIR:   At5g19890
Protein sequence: AtPrx59 (At5g19890 / PER59 / AtperoxP59 / PeroxidaseN / AtatPN / AtPN)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   34886.88 (31881.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.85 (6.73) Peptide Signal:   %s   cut: 29 range:29-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTQTKVMGGHVLLTVFTLCMLCSGVRAQLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHDCFVNGCDASLLLDGADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTLAARDSVVLSGGPGWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVFSNRLFNFTGLGNPDATLETSLLSNLQTVCPLGGNSNITAPLDRSTTDTFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIRMGNISNGASGEVRTNCRVINN

Retrieve as FASTA  
Remarks Complete sequence from genomic, 7 cDNA and 27 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATAGTGATG CGACATATTG CTTGTAATAA ATGAATAACA TTCATCATAT TTTCTTTTTA ATAATATCAC AGGAATTAAT AATTCACTAA ACTCAAGTTT AATAATTCGC CAATTTCAGT  TTTGAACATG TAACATATAA GAATATTTAG TTATTTACGA TGGTATAATT TGAAAATATA TTGCATTCTA ATAACAATTT GTTAACCATT GTTTTATTTT GTGTAGCCTG TAGGTTTAGA  TTGCTTCTCA ATGTCAAGTG TAAAGGTGAA CCATCTTATG AGTTATGACA CACTGCCTGA AGAACGGATG TTTCAATGAA TAATCGGAAT TTCTATCAGT TATTGAAGTC TCTTAATCTA  ATTTACGTTG CTTTTCTCTT ATTCAAATCT TCTCTAATTT CAGTTGTTGT AAGTTCTATG TGGATCGATC GATTCCAATC GTTGTAAAAG TCGATTTAGT CAATGAAGCG TTTGTGTGAA  TATTAAAACA AAAAATCAAG AAAACTGTGA TCGAGTTTTT TTGTATCTGA AAAAAACAAC AACATTGAAA AATATCTATT TTTATATGAA ACTCAAGAAC CAAGGATTTA ATGTATATGT  ATACATGTTT AATAAACTTT CTTTTACCAA ATTCAACAAT TTTGAAAAGA TTATCATACG AGATTCTTCT TTCTCTCTTT CTTTGATTTT ACGTAATTTT TATGAAAAAC TTTGTACTTT  AGTTAGTCTG GTTTTCTGAA CCTTTAAAAA TATCTCTTAA CTACGATTTG GTGATACAAA ATGCTCTAGA GGGATCGAAC GTGGAATTTA CACAAGTATG CGACGTTGAC ATACGAATTA  AGAATACAGA TAATTAAAAT ACATGTGGTA AGACTGTGGT ATATGTATTT TTATATCGCA TGCCGATAAT GCTAAGAACA CGAGGAATTG GAACGTTTTG GGTCTTTTGG ACTATGCACT  TTGTAAACTA ACAAATTATT AAAAAATCGC CGCAAGTTGC AAAGTTCGAG GAGGAAGTAA GAACACAAGA GACTAACTAT TACGTGGAAT CTACCATTAA GATTGTTTTC CGAAATTCAG  AGATATACAT GTTCTTTTGG TTTTTTTTAC GAAAATATGA TGTTATCCAT TCGCCATTTT GCGTTCTTAA TTAACAATCA AGTTTCACAA AATTTAAATG TGCAAGTAGA GTAGTCAAAT  ATGGTTTACA AACAAAAAAA CACACTGATT TTCAGAAATA TGATATTAAT TGGGATTTTA GTAAGTCATT TATCAAATTC GTAAAAAACT AAACATGCAT AACTTTTTAT AAAAAAAATA  AAATAAAAAA AACTGTTGAT AATATTTTCA TATCGGCAGA ATGTGTCTAG ATACGTTGTT TTGGATAAGT CATGCAATTA GAGAAGTGTG GAAAGAATGA CATAAATAAT TTGTTAACAA  TTTTTACATG CGCATGTACA AGTACATATA GAAAATTAAT AGTCCAAATT TTTCATAGTA AAAGAAAAAA ATGAAACTCA ATTGCATGCT TTAATTACAT ACGAGTGGGG AGAGTTGATT  TATACCAAAT CCACTTGCGT TCTCAAAATA CATTAAAATA CAACACTATT GAAACAAAGT TGACTACATG ATGTTAGCTA GTAAACACAG TCACTTGTTT TAGTGGATTA AACGTAAGTA  GATCAAACCG GCCAACTTAC TAAATAACAA GATAGAAATT CATGAATCTA TGAACGTAAA TGGCTCTTAG TGCCTAATCT TACATGAATT ATAATAATAT GGAGTTTAAT GCATCCTCTT  GAGCATAAGA AATCAATCTT TCAAAGCCGC CACACGTCAC TATGCACTAA TCATTCTCTT AATAGCCCAC TGGCAGAAGC ACAATTAAAC CCTTGATATC GATCGTTACT ATCTAGTTTT 
CTCTATAAAT AGAACTCCAA TTCTTTCTAA GTAATAATAA ACTATCTCTT TAGTAAGTCT TTTAAACAAG CTATCTAGAT A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATGTGTGTG TGTTTTCGAG TTTATGTAAT GTTTGGGAGT TGATCGGTCT CGTGTGTATC AGAATGATCA CGTGTGTAAT AATAAGAATT AATGGGGTTT GTTGGTTTGC CTAATTAAAA  GTGATTTGGT AAACCTGGAA ATTTTCATTG ATTTTAAAAT TAAACAAGTG TGTTGTAAAC CAAAACATGT GGATTTCAAA CCAAAAAAAT GGATTCGAAA CTCCTAAAAT TTATGATCAT  AATAATGCAA GCACAATATA TAGAAGCTTC CATTGTTATT AATTTTGAAA TAGCGTCGTA TGTGATTTTC TTGGATTAAG AAAAATTACT TTGTTAGGGT TGTTAAAGGG TTGCTTTGTT  AGTTTTTTAA GGATATATAT CCAAAATATT TACAACCAAG GGGATATGTA GTTGCAGCAC TTCTTTGATT CTTTCGAATA AGAAGATGAA ACCAATATTA ATCAATCAAT ATAATGGAAC  AAAATATCGA CCGCCGGTAA TAATTAGCTG AAAGCCTGAA ACCAAAATAA GGAAAGGAAA AGAAAAAGTT TTATATACTT CTAGTTTTTA TGGAACGCAA GGAATCTTTG TGCGCATATG  AAAACGACCC CGTCCAATTG TTTTGAGACA GCTGACTCCG ATTAATCATT TTTTTTGTCA ACAAAACTGA CTCTATTACG ATGGCTTGAA TACGACAGTT TCAAATTTAC GCGGAAAGGA  ATAGTAAGCA TTATGCGATT CCAACAAGTA ATTCATAATT AGTGTTGACG TAAGTTAGTT TTTGTTTTCT TTAATTAACT GATTTTTCAT TAATACTTTT TAATTATAAA CATGAATTTG  ATTAACTCGA TCGTTTACTT AAAATTCATT TCAATCAATT TCAGAGCAAC GACTACAAGT AAAAGACAAT ATTTAAAATT TGAACTTTGT ATACGATCTG AGTTTCTATC TACTGACTAC 
TGTATTTGTA TCTGAGGTGA ATTAGCTAAA TATGAACATG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACACAAACCAAAGTGATGGGAGGACATGTCTTGCTTACTGTTTTCACTCTTTGTATGCTTTGTTCAGGGGTTAGGGCACAGCTAAGCCCTGACATTTATGCTAAATCGTGCCCC
AATCTAGTTCAAATTGTCCGTAAACAAGTTGCCATCGCCCTGAAGGCCGAGATACGGATGGCTGCTTCTCTCATTCGTCTTCATTTCCACGACTGCTTTGTTAAT
GTATGTATTTGTTAT
CTTTACGTGTTTTTTTCTATTATAGAATTTTATAGGTTATAGGATGTTGTTACAAAATAATGTTCCAAACACTTTTCATAAGTTTCCTAAAACGTAACTCGAACTTTTCAGGGGTGTGAT
GCGTCGTTATTGTTGGATGGAGCTGACAGCGAGAAACTCGCGATCCCAAACATTAACTCTGCTAGAGGATTTGAAGTAATTGATACAATCAAAGCCGCTGTGGAAAACGCATGTCCTGGT
GTTGTTTCTTGTGCTGATATCCTCACTTTGGCCGCTCGTGACTCCGTTGTATTG
GTAAGCTAGCCCTTTTGTCCCCATTTAACAACCATCAAAGCCTTAATATATTTACTTTATTTTCAG
AGAAATTCTCGAGATTTTACTAATTTTCATACAACAACTATTTATAATATGAATTAGGTGGTGACTATTTATAGTAACAAACAAAATGATTATGTTTTTACAAATGATTATATATTCTAT
TATAATATTGTAATTATATATCTTCCTTCGTCTATAACTTACACATGTATACTCTCGGAATTAAATTAACCTGGATTATATCTATTCGATATTATGTCGCCTATAACGGGTTTAAATTTG
TAGAGTGGAGGGCCTGGGTGGAGAGTGGCATTAGGAAGAAAAGATGGATTGGTGGCAAATCAGAACAGTGCAAACAATCTACCATCTCCTTTTGAACCTTTAGACGCCATTATCGCCAAA
TTTGTAGCCGTAAACCTTAACATCACCGACGTCGTAGCTTTATCAG
GTTTAACTAGTTTCTTCAAACCTTAGTTGGTATTCTTTTATTCTAAGTACTTATCACTTATGTAAGCCCTTTTT
CATTACAAAGGAGCTCACACCTTTGGACAAGCGAAGTGTGCTGTCTTCAGCAACCGTCTGTTCAACTTTACCGGCTTGGGAAATCCCGACGCAACACTTGAGACATCACTCTTGTCTAAT
CTGCAAACAGTTTGTCCGCTCGGAGGAAATAGTAACATAACAGCACCTCTTGACAGGAGCACTACGGACACCTTCGACAACAATTATTTCAAGAACCTGCTTGAAGGAAAAGGTCTTTTG
AGTTCTGATCAGATTCTGTTCTCGAGTGACTTAGCCGTGAACACCACAAAGAAACTAGTGGAGGCTTATAGTCGGAGCCAGAGCTTGTTTTTCAGGGACTTCACATGTGCGATGATCAGA
ATGGGAAACATTTCGAATGGAGCTAGTGGGGAGGTTAGGACAAACTGCAGGGTTATCAATAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACACAAACCAAAGTGATGGGAGGACATGTCTTGCTTACTGTTTTCACTCTTTGTATGCTTTGTTCAGGGGTTAGGGCACAGCTAAGCCCTGACATTTATGCTAAATCGTGCCCC
AATCTAGTTCAAATTGTCCGTAAACAAGTTGCCATCGCCCTGAAGGCCGAGATACGGATGGCTGCTTCTCTCATTCGTCTTCATTTCCACGACTGCTTTGTTAAT
GGGTGTGATGCGTCG
TTATTGTTGGATGGAGCTGACAGCGAGAAACTCGCGATCCCAAACATTAACTCTGCTAGAGGATTTGAAGTAATTGATACAATCAAAGCCGCTGTGGAAAACGCATGTCCTGGTGTTGTT
TCTTGTGCTGATATCCTCACTTTGGCCGCTCGTGACTCCGTTGTATTG
AGTGGAGGGCCTGGGTGGAGAGTGGCATTAGGAAGAAAAGATGGATTGGTGGCAAATCAGAACAGTGCAAAC
AATCTACCATCTCCTTTTGAACCTTTAGACGCCATTATCGCCAAATTTGTAGCCGTAAACCTTAACATCACCGACGTCGTAGCTTTATCAG
GAGCTCACACCTTTGGACAAGCGAAGTGT
GCTGTCTTCAGCAACCGTCTGTTCAACTTTACCGGCTTGGGAAATCCCGACGCAACACTTGAGACATCACTCTTGTCTAATCTGCAAACAGTTTGTCCGCTCGGAGGAAATAGTAACATA
ACAGCACCTCTTGACAGGAGCACTACGGACACCTTCGACAACAATTATTTCAAGAACCTGCTTGAAGGAAAAGGTCTTTTGAGTTCTGATCAGATTCTGTTCTCGAGTGACTTAGCCGTG
AACACCACAAAGAAACTAGTGGAGGCTTATAGTCGGAGCCAGAGCTTGTTTTTCAGGGACTTCACATGTGCGATGATCAGAATGGGAAACATTTCGAATGGAGCTAGTGGGGAGGTTAGG
ACAAACTGCAGGGTTATCAATAATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATAAACTAT CTCTTTAGTA AGTCTTTTAA ACAAGCTATC TAGATAATGA AAACACAAAC CAAAGTGATG GGAGGACATG TCTTGCTTAC TGTTTTCACT CTTTGTATGC TTTGTTCAGG  GGTTAGGGCA CAGCTAAGCC CTGACATTTA TGCTAAATCG TGCCCCAATC TAGTTCAAAT TGTCCGTAAA CAAGTTGCCA TCGCCCTGAA GGCCGAGATA CGGATGGCTG CTTCTCTCAT  TCGTCTTCAT TTCCACGACT GCTTTGTTAA TGGGTGTGAT GCGTCGTTAT TGTTGGATGG AGCTGACAGC GAGAAACTCG CGATCCCAAA CATTAACTCT GCTAGAGGAT TTGAAGTAAT  TGATACAATC AAAGCCGCTG TGGAAAACGC ATGTCCTGGT GTTGTTTCTT GTGCTGATAT CCTCACTTTG GCCGCTCGTG ACTCCGTTGT ATTGAGTGGA GGGCCTGGGT GGAGAGTGGC  ATTAGGAAGA AAAGATGGAT TGGTGGCAAA TCAGAACAGT GCAAACAATC TACCATCTCC TTTTGAACCT TTAGACGCCA TTATCGCCAA ATTTGTAGCC GTAAACCTTA ACATCACCGA  CGTCGTAGCT TTATCAGGAG CTCACACCTT TGGACAAGCG AAGTGTGCTG TCTTCAGCAA CCGTCTGTTC AACTTTACCG GCTTGGGAAA TCCCGACGCA ACACTTGAGA CATCACTCTT  GTCTAATCTG CAAACAGTTT GTCCGCTCGG AGGAAATAGT AACATAACAG CACCTCTTGA CAGGAGCACT ACGGACACCT TCGACAACAA TTATTTCAAG AACCTGCTTG AAGGAAAAGG  TCTTTTGAGT TCTGATCAGA TTCTGTTCTC GAGTGACTTA GCCGTGAACA CCACAAAGAA ACTAGTGGAG GCTTATAGTC GGAGCCAGAG CTTGTTTTTC AGGGACTTCA CATGTGCGAT  GATCAGAATG GGAAACATTT CGAATGGAGC TAGTGGGGAG GTTAGGACAA ACTGCAGGGT TATCAATAAT TAGCATGTGT GTGTGTTTTC GAGTTTATGT AATGTTTGGG AGTTGATCGG  TCTCGTGTGT ATCAGAATGA TCACGTGTGT AATAATAAGA ATTAATGGGG TTTGTTGGTT TGCCTAATTA AAAGTGATTT GGTAAACCTG GAAATTTTCA TTGATTTTAA AATTAAACAA 
GTGTGTTGTA AACCAAAACA TGTGGATTTC AAACCAAAAA AATGGATTCG AAACTCCTAA AATTTATGAT CATAATAATG CAAGCACAAT 

Retrieve as FASTA