Entry information : AtPrx60 (At5g22410 / PER60 / AtperoxP60 / ATP14a / AtP14 / RHS18)
Entry ID 226
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-10 (Achraf Jemmat)
Peroxidase information: AtPrx60 (At5g22410 / PER60 / AtperoxP60 / ATP14a / AtP14 / RHS18)
Name (synonym) AtPrx60 (At5g22410 / PER60 / AtperoxP60 / ATP14a / AtP14 / RHS18)
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx60
start..stop
S start..stop
AhalPrx04 597 0 1..331 1..331
AlyPrx60 593 0 1..331 1..330
BstrPrx69 564 0 1..329 1..328
CrubPrx121 523 0 1..329 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7426347..7426565 219 N° 2 7426675..7426854 180 N° 3 7426947..7427112 166 N° 4 7427292..7427722 431
join(7426347..7426565,7426675..7426854,7426947..7427112,7427292..7427722)


exon

Literature and cross-references AtPrx60 (At5g22410 / PER60 / AtperoxP60 / ATP14a / AtP14 / RHS18)
Protein ref. UniProtKB:   Q9FMR0
DNA ref. Phytozome 12:   Chr5 (7426347..7427722)
mRNA ref. GenBank:   NM_122146
Cluster/Prediction ref. Phytozome Gene 12:   19666652 UniGene:   At.24060
Omic ref. AtProteome:   At5g22410 ATTED-II:   At5g22410 e-FP Browser:   At5g22410 ePlant:   At5g22410 Genevestigator:   At5g22410 TAIR:   At5g22410
Protein sequence: AtPrx60 (At5g22410 / PER60 / AtperoxP60 / ATP14a / AtP14 / RHS18)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   35894.25 (33177.8)  
PI (pH):   %s   6.97 (6.88) Peptide Signal:   %s   cut: 27 range:27-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVKISTIEVLILSLALLSFGHGCYGQLRLGFYSQNCQNVENIVSKVVGEAFIKDSSIAPAMIRLYFHDCFSNGCDASLLLDGSNSEKKASPNLSVRGYEVIDDIKSAVEKECDRVVSCADIIALATRDLVTLASGGKTRYEIPTGRLDGKISSALLVDLPSPKMTVAETAAKFDQRKLSLNDMVLLLGGHTIGVTHCSFIMDRLYNFQNTQKPDPSMDPKLVEELSAKCPKSSSTDGIISLDQNATSSNTMDVSFYKEIKVSRGVLHIDQKLAIDDLTSKMVTDIANGNDFLVRFGQAMVNLGSVRVISKPKDGEIRRSCRSTCNNPLCV

Retrieve as FASTA  
Remarks Complete sequence from genomic. 2 cDNA and 3 ESTs (1 only in roots)
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACCCTTTTCA ACATTGATCT TATCGATTAA GCATGTAAAT AGTTGGATGA ACAATGCAAC CTTCACAGAA TCTAACAACT AAGAGATAGT ATCTAAGACA TCAAATATAG ATGTTTGAAG  ACAAGTAACT ATAGTATAAC TGCAAGAATG AACACATTGG TTCATGGCTC AATAGCCCAA TCTTGTAAAT ATGAAGTGTT TAGCTTCCAC GGAAACACAT AGCTATGAGA CTGAAAAAAC  AGAGAGAGAC AAGAACGTGC TCTAATCACT TCATGTACTG ACTGATAAAG GAATCAAAAA TCAAATAAGT TCTTCTCGTT TTGGTTTCAC TAATTCCACA TAAACCTTAA TCTGTATACA  ACCAAAACTT AGAGGTTCTA CAACTCGAAA CAAGGAAGCC TTAATCAGAA GCATTCTATA TCCATCTGCT CACCCACCCC AAAATTGCAG GACAAGATCA TTGTTGTGAG GAGACTTTTA  AGAGCAATTC AATAAAAAGG TAGGATCTTT GGACAATGTA CCTGGCGCTT GGAGCTCTTC TAGGAACTTC AGGCTCGAAT TCAACAGGCA AACCCAAGAA GCCATTGAAA CGATCAAAGG  TAACGTGCGC CACGTGTCTG ACATTGGTAG GCCATCCAAT CTCCATGCTA CAAAGCTCCC TCCGGTTACT CTTGCAAGAA ATCAAAGATC TCCTGAAAAT GGCAACAAGA AGAGCCAACA  ACGAAATCTG ATCTTCCCCA CCATCGTCTT CTTCTCCTCC ATCGGTACTG CTCCGTCTTC TCAAATCTTG TTCTTCGATT GAGGCATGAA AGTCAACATC TTGATCGAAT CTAGCAACTG  GGTTTCTCCG GTTGTGGTCA GAGCTAATCA AGAGAGTCGC ATTAGAGCGA GAGGCGTAAG ATAAAGAAGA AGGTGAAGGA GAAGAAGAAG AAGAAGAAGA TGAATGAGAA GCGCTTGGAG  ATGAAGGAAA GTGAAGAACT TCAGTCATGG CGCTTCAGAT TTTGGCAAAG GAAACAACTT TTTTGGTTCA AATCATTTGT CAATGAAAGA AAAGGTTTTG AATTGAAGGA AATGTATAAA  CCCGGAAATA GAGCTCAAGA TCGAAGATTA GATTGTTGAT TCAAAACCCT AATTAGATGA ATTCGGTTGC CACTAATGAA CAAAAAAACA GAGTTTTGTT ACTACTAATT AAATTTAAAT  AAATGACTAA ACATTGACCA TAAAAAGTGG TTAAACCATA TAAAAATAGT TGAATAAGAT AAGTTTTGGT AACACAAAAA AAAAAGAGAA TACTACTGAT TGTTACATAT TTATGATTGA  TTTTAGTTAA ACTATTGGAG GTTTTACAAT TAAATTAGTT AACATTAAGT ATTGATATAA AAGGATAAAC ATTGATATAT TAATGTTTAC AAGTCCTTAT CACTTATAAA TGTGGATTTC  GTTTGGGGGA AAATCAGTAT ACTTTATGAT TTTTGCACGT TTTCTAAAAT GTGAAACCAT GTTATGTTCT TAGATTAGTA GTATCCACGT TTTCACAAAA TATACCATTC AAACGCTTGC  TCTATAGTAC ATAATCCCTA TGTTGAGCCA GTAGTTAAGA AGCATTTTGC TGAATTTACT AAAACAAAGA TCAAGGATTT TATTGCGTTT TAAAGATAAA CTCGTGTTAT GCATACAAGT  GATTTGCTTA CAAAAAATTA TGTGATATAT ACTCTTCCTA TGGGAGAAAA AAAAAAGAAT TGAAGAAAAC ATTAGAAAAA CGTATCTTAT TATTTGCATT CGGATTGCCA ATTTTATTAT  AAAATAGAAC CAGCCCGACA TTAGAAAATC ATAATGTGAT CGCATGAGTG AGCTAGAATC AAATACTATA TCCATGAACG CACGTTAGAG AATCGTGCTT GCCACACATT TGGTAACAAA 
CTTGAACACT ATAAAAGTTG TTAACAATTT TTCTACAGTT CCCCACATAC TAGAATTCAT ATAGAAATTT CAACTAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAGTTGAAT AAAGTTACGC GCTATATTTT TTGTTTTGTT TAATGTTATT GTGTTCACAT TTTTTTTATT CATATGTCAT TATTTTTTTA TTTGGGTTGT TAAGTATTTT ATATTGTTAT  GGCATCTAAG TTTTTTTGTT TATTGTTATT GTGTTAACTT TTTTTTTGTT TATCTGCCTT TGTTAATTTG GGTTGTACTA TCACTGAGTC TCACAGTTCT GGTGCTTCAA CAGTTCGACT  ACAAAATGAC CTCCTTTTTG CATCAATCTC TATTTATAGA TTCACATGTG GATGTACTAC AATGTTTTAA TCGACTAGAG TCAAGGAAAC CTAATTTAAT ACATTTAATG ACCTCCTTGA  ATGGGAAGTT AGGATTGGTG CTTTGTCATA TTTGCTTTTG CAGCCGAAGT TAGGATTGTC AATTCTGCTC TAGATGCAGA GGCAGTCACA ATCAATAGAT CACTATTAAT GATGCTCATA  GATCACCATT TCTCTCAGAT TAATGGTATA AGGCTAATCG AAAATGACAG AGTGATGCAA GTATAGCCGT TCGTTATAGT TACGAGTGTT AGAGGTAAGA CTGTCCATTG TTGGTATGAC  GCATGAAAGA TTTGTCAGTA GGAGATTCGA GTACTACACG TGTAGAATTG TTTGCGGAGT CGTTCATCAT AATTGCATGA TTTAGATATA GCTAGATCTG ATAAATTGAT CATCATATTT  GTAATATGAT TATATCAAAG TATCTATGAT GATAATGTGG CAGACGTCAC AAAAAAAGTT TCGAAGTAAA AAAAAAAGAG GTAAATTTAA CTTGTTTGTA TTCAAATCAA TTTTCTTCTT  GATTAATAAT TAAATCCCCA CCCAACGTGA TTCTTTTCTT TAATTTTTAG TAAGAAGCAA GAAATGTGAC ATTCCTAGAC AATTACATCA CCAGACTCTT TCCTAACTCT TGCCTTTATT 
AATAGGACAA TATTTTGGTA GGATTTGAGT AATTGCTAGG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTGAAGATCTCGACCATTGAAGTATTGATCCTCTCCCTTGCTCTACTTAGCTTCGGCCATGGTTGTTATGGCCAGCTTCGACTCGGATTCTACAGTCAAAATTGCCAAAACGTC
GAAAACATCGTATCTAAAGTTGTTGGAGAGGCATTCATCAAGGATTCATCGATTGCACCCGCAATGATCCGCCTTTATTTTCACGATTGTTTTAGCAAC
GTAAGTTGGTTGATACTTCAT
TATACTACAAATTTCTCTAGAATATCCTAGAGAGTCTCAAAAGAAATAAATATTGATCTTTAATTTGTTGTATCAAAAATGTATGTAGGGGTGTGATGCATCGCTTCTTCTAGATGGTTC
GAACAGTGAGAAAAAGGCGTCACCAAATCTAAGTGTACGCGGATACGAAGTGATAGATGACATTAAGTCTGCGGTCGAAAAAGAATGTGACAGGGTCGTTTCTTGTGCTGATATCATAGC
TCTCGCGACTAGAGATCTTGTTACTCTT
GTAAACACCTCTCTTTTATCTACAACCTTTTATTTTACATAATATGTTTTCCTAATCAACTTCAAAAATATAATTTACATTTTTGTTTGAAG

GCAAGCGGAGGGAAAACACGATATGAGATACCAACAGGACGATTGGACGGTAAAATCTCTTCGGCTTTGCTTGTCGATTTGCCGTCTCCAAAGATGACCGTCGCGGAAACTGCTGCTAAA
TTTGATCAGAGGAAACTTAGCCTTAACGATATGGTTCTACTTCTTG
GTATGTGAAGTAAACATATTAAATTCAAATCATATATTTTTTGTTGTTTACAAGTCAAACATCACCCTACCGAA
TTTGAATTTAGTTTCTAAAATGACTAGTAAAAACAACTACTAAATCTTTTGGTTTTCTAAATTTATAGTGACATTTGTTTTGCGTTTAACTTTATAAATGTATAGGTGGACATACGATTG
GAGTGACACATTGTTCCTTCATTATGGACAGATTATATAACTTTCAAAACACGCAAAAGCCTGATCCATCTATGGATCCTAAATTGGTCGAAGAACTAAGCGCCAAATGCCCTAAGAGTT
CATCAACCGATGGCATCATTAGTCTGGATCAAAATGCTACTAGCTCGAATACTATGGATGTATCTTTCTACAAAGAGATAAAAGTTAGCCGTGGAGTCCTTCATATCGATCAAAAACTTG
CCATCGACGATTTGACAAGTAAGATGGTGACGGATATAGCCAACGGTAACGATTTCTTGGTTAGGTTTGGTCAGGCAATGGTGAATTTGGGATCGGTGAGAGTTATTAGTAAGCCCAAAG
ACGGGGAGATAAGAAGATCATGTCGTTCTACTTGCAACAATCCATTATGCGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTGAAGATCTCGACCATTGAAGTATTGATCCTCTCCCTTGCTCTACTTAGCTTCGGCCATGGTTGTTATGGCCAGCTTCGACTCGGATTCTACAGTCAAAATTGCCAAAACGTC
GAAAACATCGTATCTAAAGTTGTTGGAGAGGCATTCATCAAGGATTCATCGATTGCACCCGCAATGATCCGCCTTTATTTTCACGATTGTTTTAGCAAC
GGGTGTGATGCATCGCTTCTT
CTAGATGGTTCGAACAGTGAGAAAAAGGCGTCACCAAATCTAAGTGTACGCGGATACGAAGTGATAGATGACATTAAGTCTGCGGTCGAAAAAGAATGTGACAGGGTCGTTTCTTGTGCT
GATATCATAGCTCTCGCGACTAGAGATCTTGTTACTCTT
GCAAGCGGAGGGAAAACACGATATGAGATACCAACAGGACGATTGGACGGTAAAATCTCTTCGGCTTTGCTTGTCGATTTG
CCGTCTCCAAAGATGACCGTCGCGGAAACTGCTGCTAAATTTGATCAGAGGAAACTTAGCCTTAACGATATGGTTCTACTTCTTG
GTGGACATACGATTGGAGTGACACATTGTTCCTTC
ATTATGGACAGATTATATAACTTTCAAAACACGCAAAAGCCTGATCCATCTATGGATCCTAAATTGGTCGAAGAACTAAGCGCCAAATGCCCTAAGAGTTCATCAACCGATGGCATCATT
AGTCTGGATCAAAATGCTACTAGCTCGAATACTATGGATGTATCTTTCTACAAAGAGATAAAAGTTAGCCGTGGAGTCCTTCATATCGATCAAAAACTTGCCATCGACGATTTGACAAGT
AAGATGGTGACGGATATAGCCAACGGTAACGATTTCTTGGTTAGGTTTGGTCAGGCAATGGTGAATTTGGGATCGGTGAGAGTTATTAGTAAGCCCAAAGACGGGGAGATAAGAAGATCA
TGTCGTTCTACTTGCAACAATCCATTATGCGTATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATACTAGAAT TCATATAGAA ATTTCAACTA AAAATGGCCG TGAAGATCTC GACCATTGAA GTATTGATCC TCTCCCTTGC TCTACTTAGC TTCGGCCATG GTTGTTATGG CCAGCTTCGA  CTCGGATTCT ACAGTCAAAA TTGCCAAAAC GTCGAAAACA TCGTATCTAA AGTTGTTGGA GAGGCATTCA TCAAGGATTC ATCGATTGCA CCCGCAATGA TCCGCCTTTA TTTTCACGAT  TGTTTTAGCA ACGGGTGTGA TGCATCGCTT CTTCTAGATG GTTCGAACAG TGAGAAAAAG GCGTCACCAA ATCTAAGTGT ACGCGGATAC GAAGTGATAG ATGACATTAA GTCTGCGGTC  GAAAAAGAAT GTGACAGGGT CGTTTCTTGT GCTGATATCA TAGCTCTCGC GACTAGAGAT CTTGTTACTC TTGCAAGCGG AGGGAAAACA CGATATGAGA TACCAACAGG ACGATTGGAC  GGTAAAATCT CTTCGGCTTT GCTTGTCGAT TTGCCGTCTC CAAAGATGAC CGTCGCGGAA ACTGCTGCTA AATTTGATCA GAGGAAACTT AGCCTTAACG ATATGGTTCT ACTTCTTGGT  GGACATACGA TTGGAGTGAC ACATTGTTCC TTCATTATGG ACAGATTATA TAACTTTCAA AACACGCAAA AGCCTGATCC ATCTATGGAT CCTAAATTGG TCGAAGAACT AAGCGCCAAA  TGCCCTAAGA GTTCATCAAC CGATGGCATC ATTAGTCTGG ATCAAAATGC TACTAGCTCG AATACTATGG ATGTATCTTT CTACAAAGAG ATAAAAGTTA GCCGTGGAGT CCTTCATATC  GATCAAAAAC TTGCCATCGA CGATTTGACA AGTAAGATGG TGACGGATAT AGCCAACGGT AACGATTTCT TGGTTAGGTT TGGTCAGGCA ATGGTGAATT TGGGATCGGT GAGAGTTATT  AGTAAGCCCA AAGACGGGGA GATAAGAAGA TCATGTCGTT CTACTTGCAA CAATCCATTA TGCGTATAAA CAGTTGAATA AAGTTACGCG CTATATTTTT TGTTTTGTTT AATGTTATTG  TGTTCACATT TTTTTTATTC ATATGTCATT ATTTTTTTAT TTGGGTTGTT AAGTATTTTA TATTGTTATG GCATCTAAGT TTTTTTGTTT ATTGTTATTG TGTTAACTTT TTTTTTGTTT 
ATCTGCCTTT GTTAATTTGG GTTGTACTAT CACTGAGTCT CACAGTTCTG GTGCTTCAAC AGTTCGACTA C 

Retrieve as FASTA