Entry information : PpePrx27 (ppa008728m)
Entry ID 2262
Creation 2005-09-26 (Christophe Dunand)
Last sequence changes 2011-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: PpePrx27 (ppa008728m)
Name (synonym) PpePrx27 (ppa008728m)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue types Epidermis
Fruits
Mesocarp
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx27
start..stop
S start..stop
PpePrx25 569 0 1..319 1..317
FvPrx17-1A 563 0 11..319 13..321
FvPrx17-1B 549 0 1..319 1..318
PpePrx52 539 0 1..317 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18071263..18071460 198 N° 2 18071563..18071754 192 N° 3 18071982..18072557 576  
join(18071263..18071460,18071563..18071754,18071982..18072557)


exon

Literature and cross-references PpePrx27 (ppa008728m)
Literature REFERENCE 1 Le Dantec,L., Cosson,P., Renaud,C., Garcia,V., Dumoulin,P., Rothan ,C., Filippi,G., Laigret,F., Moing,A. and Dirlewanger,E. Peach (Prunus persica (L.) Batsch) fruit ESTs from two early development stages.

REFERENCE 2 Lazzari,B., Milanesi,L., Stella,A., Caprera,A., Bianchi,F., Vecchietti,A. and Pozzi,C. ESTree DB: a Tool for Peach Functional Genomics. Unpublished (2004).
DNA ref. Phytozome 11:   scaffold_6 (18071263..18072557)
EST ref. GenBank:   AJ873798.1 [3' end]
Protein sequence: PpePrx27 (ppa008728m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (302)
PWM (Da):   %s   35588.08 (33506.9)  
PI (pH):   %s   6.77 (6.66) Peptide Signal:   %s   cut: 20 range:20-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLFSLFLLHIIVSAAGAQLRPHYYSESCPKAEAVVRHVMKKALIREPRSLASVMRFQFHDCFVNGCDASLLLDDTPTMLGEKLALANINSLRSYEVVDEVKETLEKVCPGIVSCADIIIMASKDAVALTGGPDWEVKLGRLDSLSASQEASDNVMPSPRANASFLVDLFGKFNLSVKDLVALSGSHSIGQGRCFSIMFRLYNQSGTGRPDPVFDPKFRGKLNKLCPLNVDQNVTGDLDATPVVFDNQYFKDLVAGRGFLNSDQTLFTFPETRAFVQLFSRDQHEFFKAFVEGMIKMGDLQVDQQGEVRRNCRVVNSRLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 3 ESTs (AJ873798, AJ873012, AJ822088). Cultivar "Fantasia".
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTGTGGTGC CTTTGACGCC GGAGAACAAA ATCCGGCCAC CTAGCCGTCG TGGATCTGCC GTGGAAAGAG AATAAGGGGA GATGAAAAGA ATTCATTGGT TGATGAAGGC CAATAAGGCT  ATTAAAGGCA TTTAATATGG GTAAACAAAA GTTAATTTTT TTTTTTAAAT GTACTATCCT CTCTGCACGC TCTTCTGCAC CTGCGAGAGG CTTTTTTAAA AAAAAAATTT CTACCTTTTG  CTTTATATAT CTACCATGTG TCAATTGGTT TTATTTTTTA TTATTTTTTT AAATTAAAAA AAATAACATG GATAGTTATG TTCTATAAAA ATAGGACCTA TTATCTGATT TTATTTTTAA  TTTTAATTTT TTTTAATATA AAAAAAGTGA ATTTATCATA TTATCCTCAT TTAATTAATA ATTTTAATTC TTAATGTTTG AATTAACTAA GGGCATTTTC TGGTATTTTA AATGTTTCAC  CATCCTTGGT CTTTTGCTTT ATATATACTA GCTTTTCTTT TTAATTTTTA AATTTATTTT TGAATTAGAA AAGATAATGG GTAGTTGTGT TCCATAAAAA TAGGATCATT ATTTGATTTT  TCTTTTAATT TTAATTTTTT AATATGAAAA AGTGTGAATT TACCATATTA TCATCATTTA ATTAATATTT TTAATTTTTA ATGTTTGCAT TAACCAAGGG TATTTCTGGC ATTTTGAATG  TTTTACCATT CTCTGCCTTT TGCTTTATAT ATATAGATAA ATAAATTAAA GATATTTTTA TATATACAAG CAATAGTTAC GAAAAAATAG TTCAAACTTA ATTTAATAAA AATTGACCTA  ATTCACGTCT ATATAAAGAT ATTATTTTAT TTTAAATGTG AAAAAAGTAA CACATTATGA GGAAGTGGAG AAGGTACTAT GTATTCCTTT CAACATAAAA GTGAGCAAAT AAAAGACATA  TGGGGATTTG TATTACAAGA TTTAGCATAA AATTGAGCTG GCTTTGCTCT TTCTTCATGC AATATTAATT GCAGACATTA ATGGCTGCTA ATATTTGTTT TAATCTATTG CACAATACCG  GCCTCTGTGT GTTGGGATTT GGTAAAGCAA AGCAATGGAT TAATACATAA CATCTTTTGA AAATGAGTCA AATAACCATT AAAGTCAATC TATAATTAAA GAAATTCAAC CGTTTTTGAA  CTCATTAAAT GGAGTTATGT GCAATCGCCT TTAGAATGTC TACCAAGGAG TGTAAATAAC ACGGTGGTTG TTATCAACAC TCTTTTATAA GAGCGCACGA ATACAAGTGA AGAGCCAAAA  TATCATTTTA TGTAAATTTT TTTTCACGTC ATTTAAGTGA CAGTGTTATT TATATTCTTT CATAAGACCA TCCACTGTTT GGGGAGGTTA TTTTCGGGGG TGTAAAGTCA CTTTTATATC  TTCTTTACAT TATTGGGATT GTAAATGTGG TTTTTGCTCT AACAGGAAAG ATGTATAATT GATTTTGCTT ACTTTTGTCC ACATTTTCTC ATTTTTTTCT CATGTAGGCC CGCAGATATG  CATCTAAATT TGCATCTTAT GGTTGTTATG CAAATTTACA ATCGTTTACA CCTCCCCATT GCATGTGATT CCGATTACAA ATGGTGTATA TTTAACATAC ACATCATTAT ACAACCCCAA  TTGAAGATGC TTTAAGAGTG TACGAATACA AGTGAATAGC GCAAATAAAG CTTCCTCCTA TAACTCAAAG GAGATAGTAT TGTATTGATA AGTAGGGATG CAACAGGTAA TCCAATACTA  TCGCCTTTGT GTCATAACTT GCCCCATATC ACTAAAAACA AAAAAGCGAG AGAAAAAAAG GGAAAGAATC ATTGCACACA CCCATTGTTT CTGTTCATGC ACAGAAGCAT CAAACAAGCT 
TAAAAACCCT CAAACGGAAC TCCAAACTTC ACCAACTCAT ATACACACCT ACCTAGTGGT GAGAATTGTC TCAAAAATTC A 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCCCTCTTTTCACTCTTCCTCCTCCACATAATAGTCAGCGCTGCCGGTGCACAACTCCGGCCTCATTACTACTCAGAATCGTGCCCGAAAGCCGAAGCTGTGGTCCGACATGTC
ATGAAGAAGGCTCTGATCCGAGAGCCCCGGAGCCTTGCTTCTGTCATGCGCTTCCAATTCCATGATTGCTTTGTTAAT
GTAAGTGAACTATATATAAAAATTACAATCCTGCGTTTCCTT
ATAAGCTTTTCTTCAACTACTAATTAATTGGTTCCCTCTTTGGTAAAAAATAATCTGTAGGGTTGTGATGCTTCATTGTTGCTTGATGACACACCAACAATGCTTGGGGAAAAACTCGCC
CTTGCAAACATAAATTCACTGAGATCTTATGAGGTTGTTGATGAAGTCAAGGAAACCTTGGAGAAGGTCTGCCCTGGGATTGTCTCTTGTGCGGATATCATCATCATGGCCTCTAAAGAT
GCTGTTGCATTG
GTATGAAACTCTCTTCTCTATATCGTTACTTCCATCTTCTTTTAGTGGAATTTCTCTTCCTAATATTCGAAGAGATCCGAATTTGAACCCCTCTGTTGATATAAAATG
AAAAAAAAAAAAAAAAAGTGATGAATAATCAACATGGGCTTGGTTTGGTTTGAGTGCAAAGTGTATAATTCTTTTCTGTTTATGGTTTGTCCATAATTAAAAAAATTAGTGTTAATCAGA
CAGGAGGACCTGATTGGGAAGTGAAGTTAGGCAGATTGGATAGCTTAAGCGCTAGCCAAGAAGCCTCAGACAACGTTATGCCAAGTCCAAGAGCCAACGCAAGCTTCCTCGTTGACCTGT
TTGGCAAATTCAATCTGTCTGTCAAAGACCTTGTTGCCCTTTCTGGTTCACATTCCATCGGCCAAGGTCGGTGCTTCTCCATCATGTTCAGGCTGTACAATCAATCCGGCACCGGCCGGC
CAGACCCAGTCTTTGATCCAAAGTTTAGAGGAAAGCTAAACAAGCTCTGCCCTTTGAATGTGGATCAAAACGTGACCGGAGACCTTGACGCTACACCGGTAGTGTTCGATAACCAGTACT
TCAAGGACTTGGTTGCAGGGAGAGGGTTTCTGAATTCAGATCAAACACTTTTCACATTTCCAGAGACTAGGGCATTTGTTCAACTGTTTAGCAGGGACCAACATGAGTTTTTCAAGGCCT
TTGTTGAGGGGATGATAAAGATGGGTGACTTGCAGGTTGACCAGCAAGGTGAGGTGAGAAGAAATTGCAGGGTGGTTAACAGTCGTCTCCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCCCTCTTTTCACTCTTCCTCCTCCACATAATAGTCAGCGCTGCCGGTGCACAACTCCGGCCTCATTACTACTCAGAATCGTGCCCGAAAGCCGAAGCTGTGGTCCGACATGTC
ATGAAGAAGGCTCTGATCCGAGAGCCCCGGAGCCTTGCTTCTGTCATGCGCTTCCAATTCCATGATTGCTTTGTTAAT
GGTTGTGATGCTTCATTGTTGCTTGATGACACACCAACAATG
CTTGGGGAAAAACTCGCCCTTGCAAACATAAATTCACTGAGATCTTATGAGGTTGTTGATGAAGTCAAGGAAACCTTGGAGAAGGTCTGCCCTGGGATTGTCTCTTGTGCGGATATCATC
ATCATGGCCTCTAAAGATGCTGTTGCATTG
ACAGGAGGACCTGATTGGGAAGTGAAGTTAGGCAGATTGGATAGCTTAAGCGCTAGCCAAGAAGCCTCAGACAACGTTATGCCAAGTCCA
AGAGCCAACGCAAGCTTCCTCGTTGACCTGTTTGGCAAATTCAATCTGTCTGTCAAAGACCTTGTTGCCCTTTCTGGTTCACATTCCATCGGCCAAGGTCGGTGCTTCTCCATCATGTTC
AGGCTGTACAATCAATCCGGCACCGGCCGGCCAGACCCAGTCTTTGATCCAAAGTTTAGAGGAAAGCTAAACAAGCTCTGCCCTTTGAATGTGGATCAAAACGTGACCGGAGACCTTGAC
GCTACACCGGTAGTGTTCGATAACCAGTACTTCAAGGACTTGGTTGCAGGGAGAGGGTTTCTGAATTCAGATCAAACACTTTTCACATTTCCAGAGACTAGGGCATTTGTTCAACTGTTT
AGCAGGGACCAACATGAGTTTTTCAAGGCCTTTGTTGAGGGGATGATAAAGATGGGTGACTTGCAGGTTGACCAGCAAGGTGAGGTGAGAAGAAATTGCAGGGTGGTTAACAGTCGTCTC
CTGTAG

Retrieve as FASTA