Entry information : AtPrx62 (At5g39580 / PER62 / AtperoxP62 / ATP24a / AtP24)
Entry ID 228
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-29 (Harold Duruflé)
Peroxidase information: AtPrx62 (At5g39580 / PER62 / AtperoxP62 / ATP24a / AtP24)
Name (synonym) AtPrx62 (At5g39580 / PER62 / AtperoxP62 / ATP24a / AtP24)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Hypocotyls
Mixed tissues
Roots
Whole seedlings
Inducers Hormon treatment
Stress treatment
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx62
start..stop
S start..stop
AlyPrx62 603 0 1..319 1..318
BstrPrx31 574 0 1..319 1..318
CagraPrx25 570 0 1..319 1..318
AalpPrx62 561 0 1..319 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15848638..15849027 390 N° 2 15848010..15848172 163 N° 3 15847281..15847687 407  
complement(join(15847281..15847687,15848010..15848172,15848638..15849027))


exon

Literature and cross-references AtPrx62 (At5g39580 / PER62 / AtperoxP62 / ATP24a / AtP24)
Protein ref. UniProtKB:   Q9FKA4
DNA ref. Phytozome 12:   Chr5 (15849027..15847281)
mRNA ref. GenBank:   NM_123320
Cluster/Prediction ref. Genebank:   833954 Phytozome Gene 12:   19670482 UniGene:   At.22396
Omic ref. AtProteome:   At5g39580 ATTED-II:   At5g39580 e-FP Browser:   At5g39580 ePlant:   At5g39580 Genevestigator:   At5g39580 RnR:   At5g39580 TAIR:   At5g39580
Protein sequence: AtPrx62 (At5g39580 / PER62 / AtperoxP62 / ATP24a / AtP24)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (297)
PWM (Da):   %s   33998.01 (31645.7) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.5 (8.42) Peptide Signal:   %s   cut: 23 range:23-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLVRSFALVIVFLSCLIAVYGQGTRIGFYSTTCPNAETIVRTTVASHFGSDPKVAPGLLRMHNHDCFVQGCDGSVLLSGPNSERTAGANVNLHGFEVIDDAKRQLEAACPGVVSCADILALAARDSVSLTNGQSWQVPTGRRDGRVSLASNVNNLPSPSDSLAIQQRKFSAFRLNTRDLVTLVGGGHTIGTAACGFITNRIFNSSGNTADPTMDQTFVPQLQRLCPQNGDGSARVDLDTGSGNTFDTSYFINLSRNRGILQSDHVLWTSPATRSIVQEFMAPRGNFNVQFARSMVKMSNIGVKTGTNGEIRRVCSAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 2 and 3), 5 cDNA and 35 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATATTATATA TTTAGGTTCC ATACACTGTC TAATTAATCA TTGTCTTATT TGAGTTTGGT CATATTTGGA TACGGTGCTA TTGAGTTTGG TCATATTTGG ATACGGTGCT ATTGAGTTTG  TATCATTAGT TTTGTTCATA TTTGGACTTC ACCCATTTAG ATCTGAACAG CTCAATTAAC ATCTTTAGAT AGATGTGCTC AACAGAAAAA TTGAGATTAT GCAATTTAGT GTTTAGGGTT  TAGGGGTTAG GGGTTAGAGA AAAATTATTT CCAATTCAAA TATCATTTGC GGGGAAATCT CAGACTATTT TCATGCAAAA TATATAGAGG CTAATTTGAA GAGGGTGCTT GTAACAAGAC  CCAGAGAAGG ATTTTAGCAA CTCATGGGCA ATTAATGTTG TCCGTATGTA CAAATAAAAA CCCAATGGAC CGACTTCAAG GTCGCAGCAT GCCAGCATCC AAACTCGTTC AGGTTATCTA  GCTTTACATT TGAAGCAAAG ACGATCACTT GCGTTACGAT TAGTTAGAAT ATGGTTTTGG TACCATAAAA ACAAGATTTA TATATAGACC ATAAGGGTTT TTACTTTTTT TTTCTTTTAA  GCTTCGACGC CAATATATAC ATATGTGTAG AGACCAAAAT TTGGTCGATG AATATACATC AACGACGACA AGATATAATA TATGATAATC TTCAATTTTT GAATTTTTCT AGTCTTTGTT  AACGTCATGC ATGGATTTTT ATAGGAAAAT AACATCTATA TTGACAAAAA TTATTTTAAG AAACAGGAAT TCATAGAAAA CTCTTCTTTT TAAAACATCT GACTTTATTA TATCCTAAAG  GGACAAGTAG AAAACTCTTT ATTTGTTATA TGTCACTATT CTGTTACAAA TTTTTATTGT TTCAAATAAA AATTAATTGC AGAAAAAATT CCTATGGACC AACAACGATG GTTAGTCTTA  GTCAGCATGA GTTCTGGCTA TTGATCAGTG ATCACCACCA ATCAACGTGT CGCCATTAGT CATTAATCTG TTATGAAAGT AAACGTATAG AATTAATCTT TATCATCACA ACATCATTCT  ATATAGCAAA CCTGGTGCGG GTAGAACCCG ATCTTTATCC GAAATATATA TCTTTACCAA AAAATCGAAC TGAAAAATTC GACATCATTC TTCCATTTCC AGATTACTAA AATTCGAACA  AAACAAACCG AACCAGTCAA AGAAACAAAG CTTAATTATT AAGAAAACCC ACTATACTAT TTTGTTATTT GTTTGTTTGT TAAAGACTAT ACTATCTATA TGTTCCGGTC AATACACTAA  TCTCTCACGA TGGATCGGTC CGTGGACTTT TGTTGAATAG TGATGTCCGT GGACTTTTGT TGAATAGTGA TTAGTGAATG TTCATGTTTT GGATATTTTA ACACTTTTGT GAGACGGTCA  GTGAACTTTT GTTGAATAGT GGATGTTCAT GTTTTGGATA TTTTAACACT TTTTCTTTTC CTAAAGTATT TTAACACTTA TTCGATTAAC CAGTCCAAAG TCGGTGCATT GTAGATGAAA  ATATCATGCA CTAATACGAG TTTCCTTAAT AAAGAATTAG AGTTGAATCA AAGTTTAACG CCTGCTAAAA CAATATTCTA TAATCACATT CATTATAAAT GATTACACAC TATTAATTAG  GAATTAGTTT GATAGAAACG AACAAAAGAG AAAAAACAAA CCCAACATGA TCTGCAATCG TCAACGCGCG AAGCCAGCTC ATGACCAATC ACATAACGCG GTTTTCAGTT TTGAATTGGA  TTACAACGTC GTCGTTTTGT CAAATTACCT CAACACTCTA GCCCCTTTCG CTGACTTCAA CATCACCATT TGACTTCTCA ATCCCTCTAT AAGTTACTCA CGTTCTCGTA TCACTTTCCA 
TGCATCTAAA ACAAACTCTA TCTACTAACT CGAAACACAC TTGCGGTCTT ATCTAAAACA CAAACCAACA AAAAGAAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGTGATTA AGTTTTTATG GCTAAAAAAA AGTGTTTATG GCTAACTCTT GTTCAAGGGC ATTTTTTTTA TAGTTTGATT TAAATTTAAA CCCAATAGAA TAGAAAGGAT ATGAGAGAAA  CCCAAAAGTG GGTTGCTGAT AAATGTATTT CATTTCTTTC GGTTTGACTT GGTGGAATAA ATAAAGTTCA ATTTCGTTAC ATGAATAGAA TTGGTGTTTT ATTAATCGCC AACCTTCCGT  GGAATACTAA TTATCACCTT GATCCAATTG ATCATTCGAA TCAAAGAAGC TTCAACAATG TGAAAGTATA ACTGAGAGAA GAGTGTCTTA ATCAGTGAGT TCAACCTACC AGTTTGATAA  GCCTACATTT CACCTATCGG CCCGAAACAC CCTAACACGG AGTACTAGGT CGAGATGTTT CCGTCAGCCT TCCTCAAAAG ACTGTTCTCT TGATACTGAT TTATACATAC ATAAATCATT  GTAACACTAC ACTAATCCAA TACCAGGTAT GGCCGAGCAC GATCGATCTT CCCTAGACTG AACAAGATCA ACCCTCACTT GTTTGAGCAT GACCAACCAT TCTTCACCAA ATTCAAATTG  TATTTAATTT AAACGGTTCG GTATCACAAA CCAACCATTG GAATGTAAAC ACCACCGTCG AATACAAAGA TTGCCGAGTC GCAACCCTTA GAGTTTCGGC TAGCCTGATC AAAGCGTGGA  TGAGCCTCTG CTCGGTGTCC TGAAAATCCT GCATGAGAAC CAGGTTTGTC TCTTTCTCTC TTCTTCTTAC GGTCTTTCTT TCACTGGATA GAGTTTTTGA ATTCGTATGT GAGAACTAAA  AGGCATATAG AAAACCTTAT CAGGCGTGAC CATCTCACAC TATTGGGCTT GTTTTGTGTG GGAGACTAAT GTGCCGCGCT GTATTCATAT GATCCACAAA ATTAAGGTTT ATATTTGGTT 
CATGAAGTCT TAGTTACATA TATCAGTCTT CCTAACTTAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCTTGGTCCGATCATTTGCTTTGGTCATAGTCTTCCTTAGTTGTCTCATCGCCGTTTATGGCCAAGGTACGAGGATCGGGTTCTACTCGACTACGTGCCCTAATGCCGAGACAATT
GTTCGGACCACTGTGGCATCTCACTTTGGTTCAGATCCAAAGGTTGCACCCGGGTTACTGAGAATGCACAACCATGATTGCTTTGTCCAAGGTTGTGATGGTTCGGTGCTTTTATCGGGA
CCTAACTCTGAAAGAACCGCTGGCGCAAACGTTAACCTCCATGGTTTTGAGGTCATTGACGATGCCAAGAGGCAGCTCGAGGCAGCATGTCCTGGTGTTGTCTCTTGTGCTGATATCTTG
GCCTTAGCGGCTCGTGATTCGGTTTCTCTC
GTAAGTTTATATATATACTAATTATACAACAATCAATATATCATATATAAGCAAAGAACTATGTCTTGATTGTTTTAAATGCCAATATTT
TGTGTTTGTATTTAGATATGAGTAAGTAAAGAGGATTAACAAAGGCAACACAATTTTTTGTTTTATATTAACTAATTTTACAAGGTATATATACGCCAAAATACAAAGATTACGTTTCTT
CATTTCTTTGGTTTTGTGTTTACAAACTAAACGTTGATACTTAAGAACTTACATAACATATATTTGAAAAAAATATAGATTTTATAATATTATATTTTCAAACAATTATGTGTAACATTT
ATGTTTGTTTTACTTGGTTTCTTCTATAATATTAACTTAGTATTGGTTACAAAGAAAGTAAAAACAAAAATAATGTACAAGCGGACAGAGAGTAATTAACGTTTGTTTGGCTTTAATTTG
CATGGGTGTATGTAGACAAACGGACAAAGTTGGCAAGTTCCAACAGGACGTAGAGATGGAAGAGTTTCCTTGGCATCGAACGTTAACAATCTTCCTTCTCCAAGTGACTCTCTAGCCATT
CAACAAAGGAAATTCTCCGCTTTTCGCCTCAACACTCGCGATCTCGTCACTCTTGTTG
GTATGTAACCTATATATCACCGTTTAGAAATCAGAATAGATCCAATACATTAGTTTGGATGG
AAACTCCTCGTACGTGTTTTTTTCTTTCATATTTTGAATATTCACTTTAATAGTTAGTGTTGTGCACTGCATGGTTTATTGTCACTCGTACTTAATTTGCATAAGAATAAGGATAACTCT
AGGATCAGGTTCATGTTTAAACCAAACATTTTCGTATTTTTCAAAGAAAATTAAGTTTTATTTCGGTGTACATATTACATATATATATTTTTCAATTATATTGTTAATCAAACTGAAGAT
GAACCTATATGAATTAATAGGAGGAGGACACACGATCGGAACAGCTGCATGTGGGTTTATCACGAACAGGATATTCAACTCGAGCGGAAACACAGCAGATCCAACAATGGACCAAACATT
TGTACCACAACTTCAAAGACTTTGTCCCCAAAACGGCGACGGATCAGCACGTGTTGATCTTGACACCGGAAGTGGAAACACTTTTGACACATCTTATTTCATCAATCTCAGCCGTAACAG
AGGAATTCTTCAATCCGATCACGTTCTTTGGACTAGTCCGGCCACAAGATCCATAGTGCAAGAGTTTATGGCACCTAGAGGCAACTTCAATGTCCAGTTCGCAAGGTCAATGGTTAAAAT
GAGTAATATTGGTGTGAAGACGGGGACAAATGGAGAAATTCGTAGGGTTTGCTCTGCGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCTTGGTCCGATCATTTGCTTTGGTCATAGTCTTCCTTAGTTGTCTCATCGCCGTTTATGGCCAAGGTACGAGGATCGGGTTCTACTCGACTACGTGCCCTAATGCCGAGACAATT
GTTCGGACCACTGTGGCATCTCACTTTGGTTCAGATCCAAAGGTTGCACCCGGGTTACTGAGAATGCACAACCATGATTGCTTTGTCCAAGGTTGTGATGGTTCGGTGCTTTTATCGGGA
CCTAACTCTGAAAGAACCGCTGGCGCAAACGTTAACCTCCATGGTTTTGAGGTCATTGACGATGCCAAGAGGCAGCTCGAGGCAGCATGTCCTGGTGTTGTCTCTTGTGCTGATATCTTG
GCCTTAGCGGCTCGTGATTCGGTTTCTCTC
ACAAACGGACAAAGTTGGCAAGTTCCAACAGGACGTAGAGATGGAAGAGTTTCCTTGGCATCGAACGTTAACAATCTTCCTTCTCCAAGT
GACTCTCTAGCCATTCAACAAAGGAAATTCTCCGCTTTTCGCCTCAACACTCGCGATCTCGTCACTCTTGTTG
GAGGAGGACACACGATCGGAACAGCTGCATGTGGGTTTATCACGAAC
AGGATATTCAACTCGAGCGGAAACACAGCAGATCCAACAATGGACCAAACATTTGTACCACAACTTCAAAGACTTTGTCCCCAAAACGGCGACGGATCAGCACGTGTTGATCTTGACACC
GGAAGTGGAAACACTTTTGACACATCTTATTTCATCAATCTCAGCCGTAACAGAGGAATTCTTCAATCCGATCACGTTCTTTGGACTAGTCCGGCCACAAGATCCATAGTGCAAGAGTTT
ATGGCACCTAGAGGCAACTTCAATGTCCAGTTCGCAAGGTCAATGGTTAAAATGAGTAATATTGGTGTGAAGACGGGGACAAATGGAGAAATTCGTAGGGTTTGCTCTGCGGTTAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCTAA AACAAACTCT ATCTACTAAC TCGAAACACA CTTGCGGTCT TATCTAAAAC ACAAACCAAC AAAAAGAAAA AATGGGCTTG GTCCGATCAT TTGCTTTGGT CATAGTCTTC  CTTAGTTGTC TCATCGCCGT TTATGGCCAA GGTACGAGGA TCGGGTTCTA CTCGACTACG TGCCCTAATG CCGAGACAAT TGTTCGGACC ACTGTGGCAT CTCACTTTGG TTCAGATCCA  AAGGTTGCAC CCGGGTTACT GAGAATGCAC AACCATGATT GCTTTGTCCA AGGTTGTGAT GGTTCGGTGC TTTTATCGGG ACCTAACTCT GAAAGAACCG CTGGCGCAAA CGTTAACCTC  CATGGTTTTG AGGTCATTGA CGATGCCAAG AGGCAGCTCG AGGCAGCATG TCCTGGTGTT GTCTCTTGTG CTGATATCTT GGCCTTAGCG GCTCGTGATT CGGTTTCTCT CACAAACGGA  CAAAGTTGGC AAGTTCCAAC AGGACGTAGA GATGGAAGAG TTTCCTTGGC ATCGAACGTT AACAATCTTC CTTCTCCAAG TGACTCTCTA GCCATTCAAC AAAGGAAATT CTCCGCTTTT  CGCCTCAACA CTCGCGATCT CGTCACTCTT GTTGGAGGAG GACACACGAT CGGAACAGCT GCATGTGGGT TTATCACGAA CAGGATATTC AACTCGAGCG GAAACACAGC AGATCCAACA  ATGGACCAAA CATTTGTACC ACAACTTCAA AGACTTTGTC CCCAAAACGG CGACGGATCA GCACGTGTTG ATCTTGACAC CGGAAGTGGA AACACTTTTG ACACATCTTA TTTCATCAAT  CTCAGCCGTA ACAGAGGAAT TCTTCAATCC GATCACGTTC TTTGGACTAG TCCGGCCACA AGATCCATAG TGCAAGAGTT TATGGCACCT AGAGGCAACT TCAATGTCCA GTTCGCAAGG  TCAATGGTTA AAATGAGTAA TATTGGTGTG AAGACGGGGA CAAATGGAGA AATTCGTAGG GTTTGCTCTG CGGTTAATTA ATCAGTGATT AAGTTTTTAT GGCTAAAAAA AAGTGTTTAT  GGCTAACTCT TGTTCAAGGG CATTTTTTTT ATAGTTTGAT TTAAATTTAA ACCCAATAGA ATAGAAAGGA TATGAGAGAA ACCCAAAAGT GGGTTGCTGA TAAATGTATT TCATTTCTTT 
CGGTTTGACT TGGTGGAATA AATAAAGTTC AATTTCGTTA C 

Retrieve as FASTA