Entry information : MgrCP01 (MagKatG1)
Entry ID 2288
Creation 2007-05-07 (Marcel Zamocky)
Last sequence changes 2011-05-18 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: MgrCP01 (MagKatG1)
Name (synonym) MgrCP01 (MagKatG1)
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Magnaporthaceae Magnaporthe
Organism Magnaporthe grisea (Pyricularia grisea)    [TaxId: 148305 ]
Cellular localisation Peroxisomal
Tissue types Appressorium
Conidia
Mycelium
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value MgrCP01
start..stop
S start..stop
CgCP01 1222 0 1..736 1..739
CcochCP1 1222 0 1..736 1..740
MmycCP1 1219 0 1..739 1..746
TterCP01 1205 0 1..736 1..739
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61827..64039 2213 N° 2 64255..64294 40  
join(61827..64039,64255..64294)


exon

Literature and cross-references MgrCP01 (MagKatG1)
Literature REFERENCE #1 Zamocky, M., Furtmueller, P.G., Bellei, M., Battistuzzi, G., Stadlmann, J., Vlasits, J. and Obinger, C. (2009) Intracellular catalase-peroxidase from the phytopathogenic fungus Magnaporthe grisea: expression analysis and biochemical characterization of the recombinant protein. Biochem. J. 418: 443-451
REFERENCE #2 Banerjee, S., Zamocky, M., Furtmueller, P.G., Obinger, C. (2010) Probing the two-domain structure of homodimeric prokaryotic and eukaryotic catalase-peroxidases. BBA 1804: 2136-2145
REFERENCE #3 Dean, R.A., Talbot, N.J., Ebbole, D.J., Farman, M.L., and Birren, B.W. (2005) The genome sequence of the rice blast fungus Magnaporthe grisea. Nature 434: 980-986
REFERENCE #4 Zamocky M., Jakopitsch, C., Vlasits, J. and Obinger, C. (2007) Fungal catalase-peroxidases - a novel group of bifunctional oxidoreductases. J. Biol. Inorg. Chem. 12: S97 (13th ICBIC conference).
Protein ref. UniProtKB:   A4R5S9 [Incorrect prediction]
DNA ref. JGI genome:   Supercontig_6.12 (61827..64294)
mRNA ref. GenBank:   FD509783
Cluster/Prediction ref. UniGene:   Mgr.15383
Protein sequence: MgrCP01 (MagKatG1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   750
PWM (Da):   %s   82694.49  
PI (pH):   %s   6.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGECPLRTANVAGGGTRNRDWWPNTLKLNILRQHTEATNPYDPNFDYAEAFKSLDYEGLKKDLRALMTDSQEYWPADFGHYGGLFVRMAWHSAGTYRVMDGRGGGGQGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWADLMLLTGNVALEDMGFKTFGFAGGRPDTWEADESTYWGGETTWLGNEVRYSSGNEGHKESGVIDGSESKKGHKDIHTRDLEKPVSAAHMGLIYVNPEGPDGIPDPVAAARDIRTTFSRMAMNDEETVALIAGGHTVGKTHGAAPSDNVGPEPEAAPIENQGLGWSNKHGSGKGPDTITSGLEVIWTKEPAKFTMNYLEYLFKYEWELTKSPAGANQWVAKNAEEFIPDAFDPSKKHKPRMLTTDLSLRFDPEYEKISRRFLENPEQFKDAFARAWFKLLHRDMGPRSRWLGPEVPKETLLWEDPIPTPDHPIIDGSDVDSLKKAILATGVAPSKLIQTAWASASTFRGGDKRGGANGARIRLEPQNKWEVNNPQQLAEVLKALEGVKADFEKSGKKVSIADLIVLAGVAAVEQAAGVPVPFTPGRGDATQEQTDVESFTHLEPAADAFRNYGKGTSRVTTEQIMVDRAQQLTLTAPELTVLVGGLRVLGANYDGSSHGVWTDKPGKLTNDFFVTLLDPYTSWKSVDGEVFEGTNSKSGKKLTGTRADLVFGSHSELRALAEVYGSADGQQKFTKDFVAAWDKVMNLDRFDVRRGIYDETRLKSKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, no intron) and 25 ESTs. Strain="70-15". Uncorrect ? prediction of 1 intron for the C-term (SwissProt/TREMBL). The abscence of the intron is confirmed with ESTs. However, the sequence behind this intron contains signal for import in peroxisomes, present in related catalase-peroxidases.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGAATGTCCACTTCGCACCGCCAACGTTGCTGGTGGCGGTACCCGCAACCGTGACTGGTGGCCCAACACCCTCAAGCTCAACATCCTTCGCCAGCACACCGAAGCCACAAACCCA
TACGATCCCAACTTCGACTATGCTGAAGCATTCAAGAGCCTCGACTACGAGGGCCTGAAGAAGGACCTCCGTGCCCTGATGACCGACTCTCAGGAGTACTGGCCTGCTGACTTCGGCCAC
TACGGCGGTCTGTTCGTCCGTATGGCCTGGCACAGCGCTGGTACATACCGTGTCATGGACGGCCGCGGAGGCGGTGGCCAAGGCCAGCAGCGCTTTGCCCCCCTCAACAGCTGGCCTGAC
AATGTCTCCCTCGACAAGGCCCGCCGCCTGTTGTGGCCTATCAAGCAGAAGTATGGCAACAAGATTTCGTGGGCTGACCTTATGTTGCTCACCGGAAACGTCGCACTCGAGGACATGGGA
TTCAAGACTTTTGGCTTTGCGGGTGGCCGTCCCGACACCTGGGAGGCTGACGAATCCACATACTGGGGTGGCGAGACAACCTGGTTGGGCAACGAGGTCCGATACTCTTCGGGCAACGAG
GGTCACAAGGAGTCGGGCGTCATCGACGGCTCCGAGTCCAAGAAGGGCCACAAAGATATTCACACACGCGACCTGGAGAAGCCTGTGTCAGCTGCCCACATGGGTCTGATCTACGTCAAC
CCAGAGGGCCCTGATGGAATCCCGGATCCGGTTGCTGCCGCACGGGATATCCGCACTACCTTTAGCCGCATGGCCATGAACGACGAGGAGACCGTCGCTCTGATTGCAGGCGGTCACACT
GTGGGCAAGACTCACGGTGCTGCACCCTCTGACAATGTCGGTCCCGAGCCCGAGGCTGCCCCTATCGAGAACCAGGGTCTTGGCTGGTCCAACAAGCACGGTTCCGGCAAGGGCCCTGAC
ACCATCACCAGTGGTCTGGAGGTCATCTGGACCAAGGAGCCCGCCAAGTTTACCATGAACTACCTTGAGTACCTCTTTAAATACGAGTGGGAGCTCACAAAGAGCCCTGCTGGTGCCAAC
CAGTGGGTTGCCAAGAATGCTGAGGAGTTTATTCCTGATGCTTTCGACCCCAGCAAGAAGCACAAGCCAAGGATGTTGACCACCGATTTGTCGCTTCGCTTCGACCCCGAGTATGAGAAG
ATCTCTCGCCGCTTCCTCGAGAACCCAGAGCAGTTCAAGGACGCCTTTGCCCGTGCTTGGTTCAAGCTCCTGCACCGTGATATGGGACCCCGAAGCCGCTGGTTGGGCCCCGAAGTCCCC
AAGGAGACTCTCCTTTGGGAGGACCCCATCCCGACTCCTGACCACCCCATCATTGACGGCAGTGACGTCGACAGCCTGAAGAAGGCCATCCTTGCGACCGGTGTTGCTCCTTCCAAGCTT
ATCCAGACCGCATGGGCTTCTGCCTCGACATTCCGTGGAGGTGACAAGCGTGGTGGAGCCAACGGTGCACGCATCCGACTTGAGCCGCAGAACAAGTGGGAGGTCAACAACCCGCAACAG
CTTGCCGAGGTTCTCAAGGCTCTTGAGGGAGTCAAGGCAGACTTCGAGAAGAGTGGCAAGAAGGTCTCAATTGCCGACCTGATTGTTCTTGCCGGTGTTGCTGCCGTCGAGCAGGCTGCT
GGTGTTCCCGTTCCATTCACTCCCGGCCGTGGTGATGCCACCCAGGAGCAGACCGACGTTGAGAGCTTCACCCACCTTGAGCCGGCGGCCGATGCGTTCCGCAACTACGGCAAGGGAACT
TCTCGAGTTACCACGGAACAGATCATGGTGGACCGCGCCCAGCAGCTCACCCTTACGGCACCGGAGCTGACTGTTCTCGTGGGAGGTCTGCGTGTCCTCGGGGCCAACTACGATGGCTCC
AGCCACGGAGTCTGGACCGACAAGCCGGGCAAGCTGACCAACGACTTCTTTGTCACCCTTCTCGACCCCTACACGTCGTGGAAGTCGGTTGACGGCGAGGTCTTTGAGGGTACCAACAGC
AAGTCTGGCAAGAAGTTGACTGGCACTCGTGCGGACCTCGTCTTTGGCTCGCATTCTGAGCTCCGTGCCCTCGCCGAGGTCTACGGTAGCGCTGACGGCCAGCAGAAGTTCACCAAGGAC
TTTGTGGCCGCTTGGGACAAGGTGATGAACCTTGACCGTTTCGACGTGCGCCG
GTGAGTTTAGCGGAAACGACCAACACGGTCACTAAGCCGATTAATGTCAAAGCCGGCGTTCCGAATC
ATTATTTTCGATGAGGTTTTGGACGTGGCTGGTCGTAGTTTCTGCATATCTTAGTAGTTCTTTCTATAACTATGAAGGATGTGCGGGGAGTTGCTGTTACTCTTCGATTGGTAAAAGCTC
TAGTTGTCGCTAAAGGTTTACGTTTTAGGGGGATCTACGACGAGACGAGACTGAAATCCAAGTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGAATGTCCACTTCGCACCGCCAACGTTGCTGGTGGCGGTACCCGCAACCGTGACTGGTGGCCCAACACCCTCAAGCTCAACATCCTTCGCCAGCACACCGAAGCCACAAACCCA
TACGATCCCAACTTCGACTATGCTGAAGCATTCAAGAGCCTCGACTACGAGGGCCTGAAGAAGGACCTCCGTGCCCTGATGACCGACTCTCAGGAGTACTGGCCTGCTGACTTCGGCCAC
TACGGCGGTCTGTTCGTCCGTATGGCCTGGCACAGCGCTGGTACATACCGTGTCATGGACGGCCGCGGAGGCGGTGGCCAAGGCCAGCAGCGCTTTGCCCCCCTCAACAGCTGGCCTGAC
AATGTCTCCCTCGACAAGGCCCGCCGCCTGTTGTGGCCTATCAAGCAGAAGTATGGCAACAAGATTTCGTGGGCTGACCTTATGTTGCTCACCGGAAACGTCGCACTCGAGGACATGGGA
TTCAAGACTTTTGGCTTTGCGGGTGGCCGTCCCGACACCTGGGAGGCTGACGAATCCACATACTGGGGTGGCGAGACAACCTGGTTGGGCAACGAGGTCCGATACTCTTCGGGCAACGAG
GGTCACAAGGAGTCGGGCGTCATCGACGGCTCCGAGTCCAAGAAGGGCCACAAAGATATTCACACACGCGACCTGGAGAAGCCTGTGTCAGCTGCCCACATGGGTCTGATCTACGTCAAC
CCAGAGGGCCCTGATGGAATCCCGGATCCGGTTGCTGCCGCACGGGATATCCGCACTACCTTTAGCCGCATGGCCATGAACGACGAGGAGACCGTCGCTCTGATTGCAGGCGGTCACACT
GTGGGCAAGACTCACGGTGCTGCACCCTCTGACAATGTCGGTCCCGAGCCCGAGGCTGCCCCTATCGAGAACCAGGGTCTTGGCTGGTCCAACAAGCACGGTTCCGGCAAGGGCCCTGAC
ACCATCACCAGTGGTCTGGAGGTCATCTGGACCAAGGAGCCCGCCAAGTTTACCATGAACTACCTTGAGTACCTCTTTAAATACGAGTGGGAGCTCACAAAGAGCCCTGCTGGTGCCAAC
CAGTGGGTTGCCAAGAATGCTGAGGAGTTTATTCCTGATGCTTTCGACCCCAGCAAGAAGCACAAGCCAAGGATGTTGACCACCGATTTGTCGCTTCGCTTCGACCCCGAGTATGAGAAG
ATCTCTCGCCGCTTCCTCGAGAACCCAGAGCAGTTCAAGGACGCCTTTGCCCGTGCTTGGTTCAAGCTCCTGCACCGTGATATGGGACCCCGAAGCCGCTGGTTGGGCCCCGAAGTCCCC
AAGGAGACTCTCCTTTGGGAGGACCCCATCCCGACTCCTGACCACCCCATCATTGACGGCAGTGACGTCGACAGCCTGAAGAAGGCCATCCTTGCGACCGGTGTTGCTCCTTCCAAGCTT
ATCCAGACCGCATGGGCTTCTGCCTCGACATTCCGTGGAGGTGACAAGCGTGGTGGAGCCAACGGTGCACGCATCCGACTTGAGCCGCAGAACAAGTGGGAGGTCAACAACCCGCAACAG
CTTGCCGAGGTTCTCAAGGCTCTTGAGGGAGTCAAGGCAGACTTCGAGAAGAGTGGCAAGAAGGTCTCAATTGCCGACCTGATTGTTCTTGCCGGTGTTGCTGCCGTCGAGCAGGCTGCT
GGTGTTCCCGTTCCATTCACTCCCGGCCGTGGTGATGCCACCCAGGAGCAGACCGACGTTGAGAGCTTCACCCACCTTGAGCCGGCGGCCGATGCGTTCCGCAACTACGGCAAGGGAACT
TCTCGAGTTACCACGGAACAGATCATGGTGGACCGCGCCCAGCAGCTCACCCTTACGGCACCGGAGCTGACTGTTCTCGTGGGAGGTCTGCGTGTCCTCGGGGCCAACTACGATGGCTCC
AGCCACGGAGTCTGGACCGACAAGCCGGGCAAGCTGACCAACGACTTCTTTGTCACCCTTCTCGACCCCTACACGTCGTGGAAGTCGGTTGACGGCGAGGTCTTTGAGGGTACCAACAGC
AAGTCTGGCAAGAAGTTGACTGGCACTCGTGCGGACCTCGTCTTTGGCTCGCATTCTGAGCTCCGTGCCCTCGCCGAGGTCTACGGTAGCGCTGACGGCCAGCAGAAGTTCACCAAGGAC
TTTGTGGCCGCTTGGGACAAGGTGATGAACCTTGACCGTTTCGACGTGCGCCG
GGGGATCTACGACGAGACGAGACTGAAATCCAAGTTATAA

Retrieve as FASTA