Entry information : AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Entry ID 230
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2016-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-03-04 (Christophe Dunand)
Peroxidase information: AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Name AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Endoderm
Flowers
Green siliques
Mixed tissues
Roots
Siliques
Vascular tissue
Xylem
Inducers Dark growth
Drought
Lignification
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx64
start..stop
S start..stop
AhalPrx17 641 0 1..317 1..317
AlyPrx64 639 0 1..317 1..317
BstrPrx12 638 0 1..317 1..317
CrubPrx43 634 0 1..317 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16852702..16852905 204 N° 2 16853004..16853192 189 N° 3 16853285..16853447 163 N° 4 16853624..16854021 398
join(16852702..16852905,16853004..16853192,16853285..16853447,16853624..16854021 )


exon

Literature and cross-references AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Literature REFERENCE 1 Tokunaga N, Kaneta T, Sato S, Sato Y. Analysis of expression profiles of three peroxidase genes associated with lignification in Arabidopsis thaliana. Physiol Plant. 2009 Jun;136(2):237-49.
REFERENCE 2 Yi Chou, E., Schuetz, M., Hoffmann, N., Watanabe, Y., Sibout, R., Samuels, A. L. Distribution, Mobility and Anchoring of Lignin-Related Oxidative Enzymes in Arabidopsis Secondary Cell Walls. JExBot 2018
REFERENCE 3 Kamiya T, Borghi M, Wang P, Danku JM, Kalmbach L, Hosmani PS, Naseer S, Fujiwara T, Geldner N, Salt DE. The MYB36 transcription factor orchestrates Casparian strip formation. PNAS 2015
REFERENCE 4 Tokunaga N, Kaneta T, Sato S, Sato Y. Analysis of expression profiles of three peroxidase genes associated with lignification in Arabidopsis thaliana. Physiol Plant. 2009 Jun;136(2):237-49.
Protein ref. UniProtKB:   Q43872
DNA ref. Phytozome 12:   Chr5 (16852702..16854021)
mRNA ref. GenBank:   NM_123583
Cluster/Prediction ref. Phytozome Gene 12:   19666549 UniGene:   At.23304
Omic ref. AtProteome:   At5g42180 ATTED-II:   At5g42180 e-FP Browser:   At5g42180 ePlant:   At5g42180 Genevestigator:   At5g42180 TAIR:   At5g42180
Protein sequence: AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (295)
PWM (Da):   %s   34527.46 (32073.2)  
PI (pH):   %s   8.91 (9.08) Peptide Signal:   %s   cut: 23 range:23-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAHMLNLLVIVIFVVSFDVQALSPHYYDHTCPQADHIVTNAVKKAMSNDQTVPAALLRMHFHDCFVRGCDGSVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKALEEQCPGIVSCADILSLAARDAVALSGGPTWAVPKGRKDGRISKAIETRQLPAPTFNISQLRQNFGQRGLSMHDLVALSGGHTLGFAHCSSFQNRLHKFNTQKEVDPTLNPSFAARLEGVCPAHNTVKNAGSNMDGTVTSFDNIYYKMLIQGKSLFSSDESLLAVPSTKKLVAKYANSNEEFERAFVKSMIKMSSISGNGNEVRLNCRRVR

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 10 cDNA and 41 EST mainly from siliques.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTATGGACTT GGAGCTCGAA GAATCGGAGT ATTTAGTGCA GTACCGGTTG GATGTGTACC AGCAGCTAGA ACACTTCGTG GAAAATTGAA GCGAAGATGC TCAGAAAAAC TTAACGAAGT  GGCTCGCAAC TTTAACGCGA AGATATCTCC AACATTGGAA GCTTTAGGAA AAGAGTTGCC AGATAGCAGA GTTGTGTTAA TTGACGTGTG TGACACTCTT AATGACATGA TAGAAAACCC  TAAAAACTAC GGTAAGTATG AATACACATC CCTTTTTCTC ATAATAATTT CATCAAGTTA TAACCGTAAA GTAAAATAGT TGATCATTTA TGTTGTGATA CGCAAGTACA AATGATAATT  AGTATTTTGA GGATTTTGTT TTGGTCCCAC ATCAGTTAAA TTTAATAAGA GACTTTGCAA ATTATTATAT GTGAGACGTC ACAAATTATT ATATGTATAT AATAAAGTGT TTAGATGGAA  ATTTTCAAAC CAATGGGAAC TACAAACAAA TTAACTTACC TCGTACAATA GCACGGGTCA TCACTTAGTT ATAGAGAATA AGAACGAAAG TCATAATAAC CATAATACTA ATATAACTTA  ATGCATATTT ATAAAATATA TTATACACTT AGAATTGATC TAAATATGCA TGGATATTTA GTCATTCAAG ATATTGTTTT ATGGATCCAT GAATTTAAAT GTTGGATCTA GACTCGCATA  CCTCCAATAT CTTGGCCATC GATAATTAGT ACCAAAAACT AACTTTATTA CCTACTAGTT ACTATCTTTA ACTTCTTTCT TTTTTATTAT AGGATTTGAA GTATCAAACA GAGGATGCTG  TGGAACCGGA TTAGTCGAAG TACTATTTTT ATGCAACAAA ATCAATCCTT TTACATGCAA AAATTCATCT TCGTATATTT TTTGGGATAG TTACCATCCA ACAGAAAAAG CTTACCAAAT  AATAGTTGAT AAGTTGTTAG GAAATTACAT TACGAAACTA GTCTAATTCT ATATTTTTAT AATATACTAA GTAATATTTT TTCCTATGTA AAAACGTAAA AAAAAAAAAT ATTTTTTCAA  TAATAAGAAA TAGTATTTAA ATGTTCATTT AGATTAAATA GATTCAATAT AGTTTGTTAA AAATGATTTA TCAATTAAAA AAACAGGTTA TATTGGATTA GACTAGTTTC GTAATGGCTA  AAAAAAAGAA TAAAACATAC GTACGAGAAC AAGACGAAGA AATAGAAGGC ATCCACTACA CAATTGTACA TGTCGACAAC AAAGTCAACG ACATACCGTT TGAGACACCG TGGCTTTCGC  TTTTCTCTCA AAAAAAAAAA ATCAATCATG TTTTTTTGGT TTTTATGTTT CGACAGTATT TGGTAGGTTG TTTTAATATT ATTAAAAACA TACTTATTAT TTGTGTGAAT ATGTTTAAAA  GCAAACTTGG TTGTTTGGAA TTGTAATATC AAATGTCAAG ATCCATCAAC TTTCATAAAA ATTCGTTAAT TTGTACGTGA ACAATTAATA AATCTCTCAT ACCACACATA TTATTGCTCT  AGTCAATTTG TTTCCTTTGT TTTCAGTCAT TTTCAGGAAT CAAATATTAG CAATGCTTTA ACTCTACTCC ACTGCAACCA AATTGGTTGT TTAGAGTTAT CAAATGACAA AACTCGTTAA  AAACTCGTTA ATATCTATTA ACCAATAAAT CTCTAGTGAA CTTTTTTCCT TTGTTTTGTT CTGTCATTTT CAGGAATCTA AATTATTAAG TCTTCAACTC TACTCCACCA CAACCAAAAT  TAAACGAGTC TTGTCTACAT GACCTAATTT GCTTAACAAC CTTATCATCT CACTAACAAC TCCATCTCCC AAAATTTAAA CTCCTTTAAC TATGCCTATA AAACCTTGAT CCATTCTTCA 
TCACATAAGC AACCCAACAA ATTCATTCTA AATACATTTC TTTTCACTCA AGAAATTAAA ATTTCGAAAA GTTTGTTAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATCTCAATC TACGCTTCCA ACATCACGTT ACTACTACAT TTTTATGTCT TTCGTTTTCT TTCGTCACAT TGATTACTTG TGAATGGGCC TTTCTAAAGA TTAAGGCAGA GGTTCTTGTA  TCAGAATTAT CTATCAATCT CTCGTGTGTG CTTGTATAGG CATTTATTTA CAAGTAATAA GATCTTTTCT CTTTCTAAGA ACATGCAGAC AAATCTTATC ACTTGTGTTC ACAACCTATC  TAAATGATTG ACGAAACAAT AGAAGACCAA CACTCTCTTT TGAGCAACAA CTTCAATATG TTTCGTAGTT AAGTCTTTAA TTTGACATAC ATAACATAAC ATTAACATCC GACCCACTGT  CTTAGCTGGA CCATCACGTA GAAGAGAATG GATATATAGT CAAAGAAAGA AGATAAGACA GGGAGACACA AATGGGTCGA GGACATGACA GCAACCTAGG TCTTCATTTT TCTTCATTCA  AACGCCCACT GATTCTCACG GCGAACCTCT TCTTCTTCCT CTGGCGTGAA GTCGTTCTTG ATATTGAACG TCTTACGGAT TTCTTCTGGG GTTTTTCCTT TAATCATATC AGCCACTGTC  TGGCAAGTCA AGTCCAACAG TCCCTTGATA TTCAAGTAGT TAGCAGCCTA AAAGGTGTCA CAGGGAAACC AACTTAGATT CAAGCTCTTC AACTTTCAGA TAAAAATGGA ACTTTATTGT  TCAAGCAAAT CAAACATATT GAACTACGAT TCCAAAGAAA ATAAACTTTA TCACTCGTTT CAGACAGAAC AAAACATGTC ATGTTAGCAT CCAAAAGGTT TCTCAGAAAA ACAAATCTAG  ATTCAAGCAA ATCCCAAAGA AATTAAACAT TATCCAATGT TTAAGACAGA ACATAAAAAA CATGAGTTTG GATGTAAAGT GGTCTTCAGC TATAAACAAA TCCAACAAAC TCAAAAGAAA 
TCTCTTGACA CTTTTTTCTC TATCAGACCA TATATTTCAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACACATGCTCAATCTCCTTGTCATAGTCATTTTTGTAGTTTCTTTCGATGTCCAAGCACTCAGTCCTCACTACTACGACCATACTTGTCCACAAGCCGACCACATTGTAACC
AATGCAGTCAAGAAAGCCATGTCAAACGACCAAACTGTCCCTGCTGCGCTTTTGAGGATGCATTTCCACGACTGTTTCGTCAGA
GTAACAACTTCTTACACACAACATTGTTGTCATCTT
TCGGTCTTTTTATGTCTTTATACTCTAAATAATGTTGTTGGTGATACTTTTGATCATTAAAGGGATGTGATGGCTCAGTTCTCTTAGACTCTAAGGGGAAGAACAAAGCAGAGAAAGATG
GACCTCCTAACATCTCACTCCATGCATTTTATGTGATTGACAATGCAAAGAAGGCATTAGAAGAACAATGTCCCGGTATCGTCTCTTGCGCCGACATTCTTTCACTTGCGGCAAGAGATG
CTGTCGCTCTC
GTAAGTCTCTCTCCATCTCAAATTCCAAGTACTACTTTTATTTGATGATTCTAATGATCCACCTAAAATATTATTTGTGGATGTTACTATAGTCAGGAGGGCCTACATG
GGCAGTGCCAAAAGGGAGAAAAGATGGAAGAATATCAAAGGCAATAGAAACAAGACAACTACCAGCTCCTACTTTCAACATTTCTCAATTGCGTCAAAATTTTGGCCAAAGAGGCCTCTC
TATGCATGATCTTGTTGCTCTCTCTG
GTATTAAACATTCTCGCACTCACTTAAAATATATTTACAAAGATTTCTAAAATCTTTTTCTTAAACTATGCTAAAAGATGCAACATAAATCTAA
ATTTTAAAAATAATTGGCAAAAGACAAATATAGTTCCAATGCTTATAATGGTTTAAATTCCGAATGTTGAATGAAATGGCAGGAGGTCATACACTAGGATTCGCCCACTGTTCATCGTTC
CAGAATAGGCTCCATAAATTCAACACACAAAAGGAGGTTGACCCAACACTAAACCCCTCATTCGCAGCCAGGTTGGAGGGAGTGTGCCCGGCCCATAACACGGTGAAGAATGCTGGATCG
AACATGGATGGAACCGTGACGTCATTCGACAATATCTACTACAAGATGCTTATCCAAGGCAAGTCACTATTCTCATCCGACGAATCGCTTCTTGCAGTACCCTCTACTAAGAAACTCGTG
GCCAAATATGCAAATTCCAACGAAGAGTTCGAGAGGGCTTTTGTGAAATCGATGATCAAGATGAGTAGTATCAGTGGGAATGGCAATGAGGTCAGACTTAACTGCAGAAGGGTTCGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACACATGCTCAATCTCCTTGTCATAGTCATTTTTGTAGTTTCTTTCGATGTCCAAGCACTCAGTCCTCACTACTACGACCATACTTGTCCACAAGCCGACCACATTGTAACC
AATGCAGTCAAGAAAGCCATGTCAAACGACCAAACTGTCCCTGCTGCGCTTTTGAGGATGCATTTCCACGACTGTTTCGTCAGA
GGATGTGATGGCTCAGTTCTCTTAGACTCTAAGGGG
AAGAACAAAGCAGAGAAAGATGGACCTCCTAACATCTCACTCCATGCATTTTATGTGATTGACAATGCAAAGAAGGCATTAGAAGAACAATGTCCCGGTATCGTCTCTTGCGCCGACATT
CTTTCACTTGCGGCAAGAGATGCTGTCGCTCTC
TCAGGAGGGCCTACATGGGCAGTGCCAAAAGGGAGAAAAGATGGAAGAATATCAAAGGCAATAGAAACAAGACAACTACCAGCTCCT
ACTTTCAACATTTCTCAATTGCGTCAAAATTTTGGCCAAAGAGGCCTCTCTATGCATGATCTTGTTGCTCTCTCTG
GAGGTCATACACTAGGATTCGCCCACTGTTCATCGTTCCAGAAT
AGGCTCCATAAATTCAACACACAAAAGGAGGTTGACCCAACACTAAACCCCTCATTCGCAGCCAGGTTGGAGGGAGTGTGCCCGGCCCATAACACGGTGAAGAATGCTGGATCGAACATG
GATGGAACCGTGACGTCATTCGACAATATCTACTACAAGATGCTTATCCAAGGCAAGTCACTATTCTCATCCGACGAATCGCTTCTTGCAGTACCCTCTACTAAGAAACTCGTGGCCAAA
TATGCAAATTCCAACGAAGAGTTCGAGAGGGCTTTTGTGAAATCGATGATCAAGATGAGTAGTATCAGTGGGAATGGCAATGAGGTCAGACTTAACTGCAGAAGGGTTCGCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAACCCAAC AAATTCATTC TAAATACATT TCTTTTCACT CAAGAAATTA AAATTTCGAA AAGTTTGTTA AAATGAATGC ACACATGCTC AATCTCCTTG TCATAGTCAT TTTTGTAGTT  TCTTTCGATG TCCAAGCACT CAGTCCTCAC TACTACGACC ATACTTGTCC ACAAGCCGAC CACATTGTAA CCAATGCAGT CAAGAAAGCC ATGTCAAACG ACCAAACTGT CCCTGCTGCG  CTTTTGAGGA TGCATTTCCA CGACTGTTTC GTCAGAGGAT GTGATGGCTC AGTTCTCTTA GACTCTAAGG GGAAGAACAA AGCAGAGAAA GATGGACCTC CTAACATCTC ACTCCATGCA  TTTTATGTGA TTGACAATGC AAAGAAGGCA TTAGAAGAAC AATGTCCCGG TATCGTCTCT TGCGCCGACA TTCTTTCACT TGCGGCAAGA GATGCTGTCG CTCTCTCAGG AGGGCCTACA  TGGGCAGTGC CAAAAGGGAG AAAAGATGGA AGAATATCAA AGGCAATAGA AACAAGACAA CTACCAGCTC CTACTTTCAA CATTTCTCAA TTGCGTCAAA ATTTTGGCCA AAGAGGCCTC  TCTATGCATG ATCTTGTTGC TCTCTCTGGA GGTCATACAC TAGGATTCGC CCACTGTTCA TCGTTCCAGA ATAGGCTCCA TAAATTCAAC ACACAAAAGG AGGTTGACCC AACACTAAAC  CCCTCATTCG CAGCCAGGTT GGAGGGAGTG TGCCCGGCCC ATAACACGGT GAAGAATGCT GGATCGAACA TGGATGGAAC CGTGACGTCA TTCGACAATA TCTACTACAA GATGCTTATC  CAAGGCAAGT CACTATTCTC ATCCGACGAA TCGCTTCTTG CAGTACCCTC TACTAAGAAA CTCGTGGCCA AATATGCAAA TTCCAACGAA GAGTTCGAGA GGGCTTTTGT GAAATCGATG  ATCAAGATGA GTAGTATCAG TGGGAATGGC AATGAGGTCA GACTTAACTG CAGAAGGGTT CGCTAGAATC TCAATCTACG CTTCCAACAT CACGTTACTA CTACATTTTT ATGTCTTTCG  TTTTCTTTCG TCACATTGAT TACTTGTGAA TGGGCCTTTC TAAAGATTAA GGCAGAGGTT CTTGTATCAG AATTATCTAT CAATCTCTCG TGTGTGCTTG TATAGGCATT TATTTACAAG 
TAATAAGATC TTTTCTCTTT CTAAGAACA 

Retrieve as FASTA