Entry information : PerVP05-1_CBS613 (VPL1 / PerVP05-1_CBS613)
Entry ID 2301
Creation 2006-07-05 (Christophe Dunand)
Last sequence changes 2011-11-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Christophe Dunand)
Peroxidase information: PerVP05-1_CBS613 (VPL1 / PerVP05-1_CBS613)
Name (synonym) PerVP05-1_CBS613 (VPL1 / PerVP05-1_CBS613)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus eryngii    [TaxId: 5323 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PerVP05-1_CBS613
start..stop
S start..stop
PerVP05-2_CBS613 720 0 1..361 1..361
PerVP05_CBS458 719 0 1..361 1..361
PoVP05_PC9 706 0 1..361 1..361
PsaVP01 698 0 1..361 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 838..901 64 N° 2 957..1093 137 N° 3 1149..1207 59 N° 4 1261..1395 135
N° 5 1446..1567 122 N° 6 1624..1699 76 N° 7 1752..1788 37 N° 8 1847..1854 8
N° 9 1903..1983 81 N° 10 2038..2107 70 N° 11 2166..2175 10 N° 12 2223..2258 36
N° 13 2323..2495 173 N° 14 2549..2588 40 N° 15 2654..2678 25 N° 16 2736..2748 13
join(838..901,957..1093,1149..1207,1261..1395,1446..1567,1624..1699,1752..1788,1 847..1854,1903..1983,2038..2107,2166..2175,2223..2258,2323..2495,2549..2588,2654 ..2678,2736..2748)


exon

Literature and cross-references PerVP05-1_CBS613 (VPL1 / PerVP05-1_CBS613)
Literature Ruiz-Duenas F.J., Martinez M.J., Martinez A.T. Molecular characterization of a novel peroxidase isolated from the ligninolytic fungus Pleurotus eryngii. Mol. Microbiol. 31:223-235(1999).
Protein ref. UniProtKB:   Q9UR19
DNA ref. GenBank:   AF007223.1
mRNA ref. GenBank:   AF007221.1
Protein sequence: PerVP05-1_CBS613 (VPL1 / PerVP05-1_CBS613)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (339)
PWM (Da):   %s   37484.76 (35335.6)  
PI (pH):   %s   4.38 (4.33) Peptide Signal:   %s   cut: 23 range:23-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFKTLSALALALGAAVQFASAAVPLVQKRATCADGRTTANAACCVLFPILDDIQENLFDGAQCGEVHESLRLTFHDAIGFSPTLGGGGADGSIIAFDTIETNFPANAGIDEIVSAQKPFVAKHNISAGDFIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPDSVDSILARMSDAGFSPVEVVWLLASHSIAAADKVDPIPGTPFDSTPGVFDSQFFIETQLKGRLFPGTADNKGEAQSPLQGEIRLQSDHLARDPQTACEWQSMVNNQPKIQNRFAATMSKMALLGQDKTKLIDCSDVIPTPPALVGAAHLPAGFSLSDVEQCAATPFPALTADPGPVTSVPPVPGS

Retrieve as FASTA  
Remarks Complete sequene from genomic (15 introns). Strain="ATCC 90787/CBS 613.91/IJFM A169".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCTGCTCTCGCGCTTGCGCTCGGCGCCGCTGTCCAGTTCGCGAGTGGTGGGCTTCGTCTCTGACCACAATGTCGAGGCAACCCTGCTGACTGGTATTTTAGC
TGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGCCGACGGACGCACCACCGCAAATGCTGCATGTTGCGTTCTGTTCCCCATCCTCGATGACATCCAAGAAAACCTCTTCGACGGTGC
CCAGTGTGGAGAAGAG
GTGTTATACCCATTGTCCTAATGCAGAACGGCTATTAATTCACGCGCGTACACAGGTGCACGAGTCCCTTCGTTTGACTTTCCACGATGCAATCGGTTTCTCTC
CTACTTTAGG
GTAAGGTAACGATCACCACTCGTGTTGTCTAATTTCTAACCCATGCACAACAGCGGAGGAGGAGCTGACGGTTCCATCATCGCGTTCGACACCATTGAGACTAATTTCCC
CGCCAATGCTGGCATCGATGAAATCGTCAGTGCTCAGAAGCCATTCGTGGCTAAACACAACATCTCCGCCGGCGACTT
GTAAGCAGTTCAAGCCAAAGGTTAAAGTGACCATTACAAATC
AATTCTAGCATTCAATTTGCTGGCGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCTTTCTTCTTGGGTCGCCCGGATGCCGTGGCCGCCTCCCCGGACCACCTCGTGCCA
GAGCCTTTTG
GTACGTTTGGATATGGTAAAATTATCAACGAGAACTGAGGGTGTGGGCTCGCATAGATTCTGTTGACTCCATTCTTGCCAGAATGAGTGACGCAGGCTTCAGTCCCGTCG
AGGTTGTTTGGCTCCTGGCTTC
GTGAGTGCATGGAGATATGTAAGTACCACCATCGATCTAATTGGTTACCTAGGCACTCCATTGCCGCTGCCGACAAGGTTGACCCATCGGTAAGTCGA
GATGCATTGGCAAGTTTGTTGTAAAGGCTAATACCTGATAATTGTCTAGATTCCTGGGTAAGAGCGAACATCCACTGACGCGGTATGCTACTGACTTCGTGTCAGAACGCCATTCGATTC
AACCCCCGGAGTTTTTGATTCTCAATTCTTCATCGAAACGCAACTTAAAGGCAGACTCTTCCCAGG
GTAAGCGATTCCATTTCTTCTCACCACGATATGACCCATCATGTTTGTATTTAG

CACTGCTGACAACAAGGGAGAAGCCCAATCCCCATTGCAAGGAGAGATCAGGCTTCAGTCCGATCACTTG
GTGAGACCATTGTAGTTCATTATTCTATCAGTAATACTGACAAATATCCA
CTGGATAGTTGGCTAGAGGTACGATTCTTCCTTGCAGCCTTGTTAATGCTCACCGCCTCCCAAAGACCCCCAGACTGCCTGCGAATGGCAGTCCATGGTTAGTGAGTAAAATATTCCCTT
TCATACTTTATAACATAGAGACTGACTACATCGCCCTACTACCAGACAACCAACCGAAGATTCAGAACCGTTTCGCTGCTACCATGTCGAAGATGGCTCTTCTTGGCCAAGACAAGACCA
AATTGATTGACTGTTCCGATGTTATCCCCACCCCTCCTGCCCTTGTCGGAGCGGCCCACTTACCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGCG
GTACGTGCACATGTTTCCCTGG
ATAAATGAGGGGTCTCACCATCTGTGATCAGTGCGCCGCGACGCCTTTCCCTGCTCTTACTGCTGACCCAGGTGAATACATGCGGTGTTAACATTTTATCACCGGGCCATTTGAACTGAC
TGATATCTCTCTTCAGGCCCAGTAACCTCCGTCCCTCCCGTGTAAGTTTTCAGTCACCCAGTATGTTATGGCGCGCTCATTGTCTACGTCTCCTACAGCCCTGGATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCTGCTCTCGCGCTTGCGCTCGGCGCCGCTGTCCAGTTCGCGAGTGCTGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGCCGACGGACGCACCACCGCA
AATGCTGCATGTTGCGTTCTGTTCCCCATCCTCGATGACATCCAAGAAAACCTCTTCGACGGTGCCCAGTGTGGAGAAGAG
GTGCACGAGTCCCTTCGTTTGACTTTCCACGATGCAATC
GGTTTCTCTCCTACTTTAGG
CGGAGGAGGAGCTGACGGTTCCATCATCGCGTTCGACACCATTGAGACTAATTTCCCCGCCAATGCTGGCATCGATGAAATCGTCAGTGCTCAGAAGCCA
TTCGTGGCTAAACACAACATCTCCGCCGGCGACTT
CATTCAATTTGCTGGCGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCTTTCTTCTTGGGTCGCCCGGATGCCGTG
GCCGCCTCCCCGGACCACCTCGTGCCAGAGCCTTTTG
ATTCTGTTGACTCCATTCTTGCCAGAATGAGTGACGCAGGCTTCAGTCCCGTCGAGGTTGTTTGGCTCCTGGCTTCGCACTCC
ATTGCCGCTGCCGACAAGGTTGACCCATCG
ATTCCTGGAACGCCATTCGATTCAACCCCCGGAGTTTTTGATTCTCAATTCTTCATCGAAACGCAACTTAAAGGCAGACTCTTCCCAGGC
ACTGCTGACAACAAGGGAGAAGCCCAATCCCCATTGCAAGGAGAGATCAGGCTTCAGTCCGATCACTTG
TTGGCTAGAGACCCCCAGACTGCCTGCGAATGGCAGTCCATGGTTAACAAC
CAACCGAAGATTCAGAACCGTTTCGCTGCTACCATGTCGAAGATGGCTCTTCTTGGCCAAGACAAGACCAAATTGATTGACTGTTCCGATGTTATCCCCACCCCTCCTGCCCTTGTCGGA
GCGGCCCACTTACCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGCG
TGCGCCGCGACGCCTTTCCCTGCTCTTACTGCTGACCCAGGCCCAGTAACCTCCGTCCCTCCCGTCCCTGGA
TCGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGCAATGTC TTTCAAGACG CTCTCTGCTC TCGCGCTTGC GCTCGGCGCC GCTGTCCAGT TCGCGAGTGC TGCTGTGCCT CTCGTCCAGA AACGCGCAAC TTGCGCCGAC GGACGCACCA  CCGCAAATGC TGCATGTTGC GTTCTGTTCC CCATCCTCGA TGACATCCAA GAAAACCTCT TCGACGGTGC CCAGTGTGGA GAAGAGGTGC ACGAGTCCCT TCGTTTGACT TTCCACGATG  CAATCGGTTT CTCTCCTACT TTAGGCGGAG GAGGAGCTGA CGGTTCCATC ATCGCGTTCG ACACCATTGA GACTAATTTC CCCGCCAATG CTGGCATCGA TGAAATCGTC AGTGCTCAGA  AGCCATTCGT GGCTAAACAC AACATCTCCG CCGGCGACTT CATTCAATTT GCTGGCGCCG TTGGAGTCTC CAACTGCCCT GGTGGTGTCA GGATTCCTTT CTTCTTGGGT CGCCCGGATG  CCGTGGCCGC CTCCCCGGAC CACCTCGTGC CAGAGCCTTT TGATTCTGTT GACTCCATTC TTGCCAGAAT GAGTGACGCA GGCTTCAGTC CCGTCGAGGT TGTTTGGCTC CTGGCTTCGC  ACTCCATTGC CGCTGCCGAC AAGGTTGACC CATCGATTCC TGGAACGCCA TTCGATTCAA CCCCCGGAGT TTTTGATTCT CAATTCTTCA TCGAAACGCA ACTTAAAGGC AGACTCTTCC  CAGGCACTGC TGACAACAAG GGAGAAGCCC AATCCCCATT GCAAGGAGAG ATCAGGCTTC AGTCCGATCA CTTGTTGGCT AGAGACCCCC AGACTGCCTG CGAATGGCAG TCCATGGTTA  ACAACCAACC GAAGATTCAG AACCGTTTCG CTGCTACCAT GTCGAAGATG GCTCTTCTTG GCCAAGACAA GACCAAATTG ATTGACTGTT CCGATGTTAT CCCCACCCCT CCTGCCCTTG  TCGGAGCGGC CCACTTACCG GCGGGATTTT CTCTTAGCGA TGTAGAGCAA GCGTGCGCCG CGACGCCTTT CCCTGCTCTT ACTGCTGACC CAGGCCCAGT AACCTCCGTC CCTCCCGTCC  CTGGATCGTA AATGCTTCGA TACCTGAATA TGCTCGTTCT GCTGCTATGA ACTTCCAATT TTTGCCATTG GGTCTGTATT CGATTCTAGA TGTTTGTGAT ATCAACTGTG TATAAATGAT 
CTTTTGAAAT ATACTTTTTT CTGCGTAGTA TGTTCGGGTG TCTACGACCA TTGC 

Retrieve as FASTA