Entry information : PerVP05_CBS458 (vpl3)
Entry ID 2305
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2011-11-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-25 (Christophe Dunand)
Peroxidase information: PerVP05_CBS458 (vpl3)
Name (synonym) PerVP05_CBS458 (vpl3)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus eryngii    [TaxId: 5323 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PerVP05_CBS458
start..stop
S start..stop
PerVP05-1_CBS613 719 0 1..361 1..361
PerVP05-2_CBS613 718 0 1..361 1..361
PoVP05_PC9 710 0 1..361 1..361
PsaVP01 702 0 1..361 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 550..613 64 N° 2 669..805 137 N° 3 861..919 59 N° 4 974..1108 135
N° 5 1159..1280 122 N° 6 1337..1412 76 N° 7 1465..1501 37 N° 8 1552..1559 8
N° 9 1608..1688 81 N° 10 1743..1812 70 N° 11 1871..1880 10 N° 12 1928..1963 36
N° 13 2028..2200 173 N° 14 2254..2293 40 N° 15 2367..2391 25 N° 16 2449..2461 13
join(550..613,669..805,861..919,974..1108,1159..1280,1337..1412,1465..1501,1552. .1559,1608..1688,1743..1812,1871..1880,1928..1963,2028..2200,2254..2293,2367..23 91,2449..2461)


exon

Literature and cross-references PerVP05_CBS458 (vpl3)
Literature Zorn,H., Langhoff,S., Scheibner,M., Nimtz,M. and Berger,R.G.
A peroxidase from Lepista irina cleaves beta,beta-carotene to flavor compounds . Biol. Chem. 384 (7), 1049-1056 (2003)
Protein ref. UniProtKB:   Q8J1S4
DNA ref. GenBank:   DQ056374.1
mRNA ref. GenBank:   AJ515245.1
Protein sequence: PerVP05_CBS458 (vpl3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (339)
PWM (Da):   %s   37498.77 (35349.6)  
PI (pH):   %s   4.35 (4.30) Peptide Signal:   %s   cut: 23 range:23-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFKTLSALALALGAAVQFASAAVPLVQKRATCADGRTTANAACCVLFPILDDIQENLFDGAQCGEVHESLRLTFHDAIGFSPTLGGGGADGSIIAFDTIETNFPANAGIDEIVSAQKPFVAKHNISAGDFIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPDSVDTILARMGDAGFSPVEVVWLLASHSIAAADKVDPIPGTPFDSTPGVFDSQFFIETQLKGKLFPGTADNKGEAQSPLQGEIRLQSDHLARDPQTACEWQSMVNNQPKIQNRFAATMSKMALLGQDKTKLIDCSDVIPTPPALVGAAHLPAGFSLSDVEQCAETPFPALTADPGPVTSVPPVPGS

Retrieve as FASTA  
Remarks Complete sequence from (15 introns) and mRNA. Strain="CBS 458.79".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCCGCTCTCGCGCTTGCGCTCGGCGCCGCCGTCCAGTTCGCGAGTGGTGGGCTTCGTCTCTGACCACAATGTCGAGGCAACCCTGCTGACTGGTATTTTAGC
TGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGCCGACGGACGCACCACCGCAAATGCTGCATGTTGCGTTCTGTTCCCCATCCTCGATGACATCCAAGAAAACCTCTTCGACGGTGC
CCAGTGTGGAGAAGAG
GTGTTATACCCATTGTCCTAATGCAGAACGGCTATTAATTCACGCGCGTACACAGGTACACGAGTCCCTTCGTTTGACTTTCCACGATGCAATCGGTTTCTCTC
CTACTTTAGG
GTAAGGTAACGATCACCACTCGTGTTGTCTTAATTTCTAACCTATGCACAACAGCGGAGGAGGAGCTGACGGTTCCATCATCGCGTTCGACACCATTGAGACTAATTTCC
CCGCCAATGCTGGCATCGATGAAATCGTCAGCGCTCAGAAGCCATTCGTGGCTAAACACAACATCTCCGCCGGCGACTT
GTAAGCAGTTCAAGCCAAAGGTTAAAGTGACCCTTACCAAT
CAATTTTAGCATTCAATTTGCTGGCGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCTTTCTTCTTGGGTCGCCCGGATGCCGTGGCGGCCTCCCCGGACCACCTCGTGCC
AGAGCCTTTTG
GTACGTTTGGATATGGTAAAATTATCAGCGAGAACTGAGGGTGTGGGCTCGCATAGATTCTGTTGACACCATTCTTGCCAGAATGGGTGACGCAGGCTTCAGTCCCGTC
GAGGTTGTTTGGCTCCTGGCTTC
GTGAGTGCATGGAGATATGCAAGCACCACCCTCGATCTAATTTGTTACCCAGGCACTCCATTGCCGCTGCCGACAAGGTTGACCCATCGGTAAGTCG
AGCTAAGTTTGTTGTAAATGCTAATACCTGATAATTGTCTAGATTCCTGGGTAAGAGCGAACATCCACTGACGCGGCATGCTACTGACTTCATGTCAGAACGCCATTCGATTCAACCCCC
GGAGTTTTTGATTCTCAATTCTTCATCGAAACGCAACTTAAAGGCAAACTCTTCCCAGG
GTAAGCGATTCCACTCCTTCTCACCACGATATGACCCATCATGTTTGTATTTAGCACTGCT
GACAACAAGGGAGAAGCCCAATCTCCATTGCAAGGAGAGATCAGGCTTCAGTCCGATCACTTG
GTGAGACCATTGTAGTTCATTATTCTGTCAGTAATACTGATAAATATCCATTGGATA
GTTGGCTAGAGGTACGATTCTTCCTTACAGCCTTGTTAATGCTCACCGCCTCCCAAAGACCCCCAGACTGCCTGTGAATGGCAGTCCATGGTTAGTGAGTAAAATATTCCCTTTCATACT
TTATAACATAGAGACTGACTACATCGCCCTACTACCAGACAACCAACCGAAGATTCAGAACCGTTTCGCTGCTACCATGTCGAAGATGGCTCTTCTTGGCCAAGACAAGACCAAATTGAT
TGACTGTTCTGATGTTATCCCCACCCCTCCTGCCCTTGTCGGAGCGGCCCACTTGCCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGCG
GTACGTGCATATGTTTCCCTGAATAAATG
AGGGGCCTCACAATCTGTGATCAGTGCGCCGAGACCCCTTTCCCTGCTCTTACTGCTGACCCAGGTGAATACATGCGGTGTTAACGTTTTATCGCCGCGCCATTTGAACTGACTGATATC
TCACTTCATTTTCTCAGGCCCAGTAACCTCTGTCCCTCCCGTGTAAGTTCTCAGTCACCCAGTATGTTATAGCGCGCTCATTGTCTACGTCTCCTACAGCCCTGGATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCCGCTCTCGCGCTTGCGCTCGGCGCCGCCGTCCAGTTCGCGAGTGCTGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGCCGACGGACGCACCACCGCA
AATGCTGCATGTTGCGTTCTGTTCCCCATCCTCGATGACATCCAAGAAAACCTCTTCGACGGTGCCCAGTGTGGAGAAGAG
GTACACGAGTCCCTTCGTTTGACTTTCCACGATGCAATC
GGTTTCTCTCCTACTTTAGG
CGGAGGAGGAGCTGACGGTTCCATCATCGCGTTCGACACCATTGAGACTAATTTCCCCGCCAATGCTGGCATCGATGAAATCGTCAGCGCTCAGAAGCCA
TTCGTGGCTAAACACAACATCTCCGCCGGCGACTT
CATTCAATTTGCTGGCGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCTTTCTTCTTGGGTCGCCCGGATGCCGTG
GCGGCCTCCCCGGACCACCTCGTGCCAGAGCCTTTTG
ATTCTGTTGACACCATTCTTGCCAGAATGGGTGACGCAGGCTTCAGTCCCGTCGAGGTTGTTTGGCTCCTGGCTTCGCACTCC
ATTGCCGCTGCCGACAAGGTTGACCCATCG
ATTCCTGGAACGCCATTCGATTCAACCCCCGGAGTTTTTGATTCTCAATTCTTCATCGAAACGCAACTTAAAGGCAAACTCTTCCCAGGC
ACTGCTGACAACAAGGGAGAAGCCCAATCTCCATTGCAAGGAGAGATCAGGCTTCAGTCCGATCACTTG
TTGGCTAGAGACCCCCAGACTGCCTGTGAATGGCAGTCCATGGTTAACAAC
CAACCGAAGATTCAGAACCGTTTCGCTGCTACCATGTCGAAGATGGCTCTTCTTGGCCAAGACAAGACCAAATTGATTGACTGTTCTGATGTTATCCCCACCCCTCCTGCCCTTGTCGGA
GCGGCCCACTTGCCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGCG
TGCGCCGAGACCCCTTTCCCTGCTCTTACTGCTGACCCAGGCCCAGTAACCTCTGTCCCTCCCGTCCCTGGA
TCGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATCCGGCC ATTATGGCCG GGGAAGATCC CCAGTCTTAC AACCCACTGC AATGTCTTTC AAGACGCTCT CCGCTCTCGC GCTTGCGCTC GGCGCCGCCG TCCAGTTCGC GAGTGCTGCT  GTGCCTCTCG TCCAGAAACG CGCAACTTGC GCCGACGGAC GCACCACCGC AAATGCTGCA TGTTGCGTTC TGTTCCCCAT CCTCGATGAC ATCCAAGAAA ACCTCTTCGA CGGTGCCCAG  TGTGGAGAAG AGGTACACGA GTCCCTTCGT TTGACTTTCC ACGATGCAAT CGGTTTCTCT CCTACTTTAG GCGGAGGAGG AGCTGACGGT TCCATCATCG CGTTCGACAC CATTGAGACT  AATTTCCCCG CCAATGCTGG CATCGATGAA ATCGTCAGCG CTCAGAAGCC ATTCGTGGCT AAACACAACA TCTCCGCCGG CGACTTCATT CAATTTGCTG GCGCCGTTGG AGTCTCCAAC  TGCCCTGGTG GTGTCAGGAT TCCTTTCTTC TTGGGTCGCC CGGATGCCGT GGCGGCCTCC CCGGACCACC TCGTGCCAGA GCCTTTTGAT TCTGTTGACA CCATTCTTGC CAGAATGGGT  GACGCAGGCT TCAGTCCCGT CGAGGTTGTT TGGCTCCTGG CTTCGCACTC CATTGCCGCT GCCGACAAGG TTGACCCATC GATTCCTGGA ACGCCATTCG ATTCAACCCC CGGAGTTTTT  GATTCTCAAT TCTTCATCGA AACGCAACTT AAAGGCAAAC TCTTCCCAGG CACTGCTGAC AACAAGGGAG AAGCCCAATC TCCATTGCAA GGAGAGATCA GGCTTCAGTC CGATCACTTG  TTGGCTAGAG ACCCCCAGAC TGCCTGTGAA TGGCAGTCCA TGGTTAACAA CCAACCGAAG ATTCAGAACC GTTTCGCTGC TACCATGTCG AAGATGGCTC TTCTTGGCCA AGACAAGACC  AAATTGATTG ACTGTTCTGA TGTTATCCCC ACCCCTCCTG CCCTTGTCGG AGCGGCCCAC TTGCCGGCGG GATTTTCTCT TAGCGATGTA GAGCAAGCGT GCGCCGAGAC CCCTTTCCCT  GCTCTTACTG CTGACCCAGG CCCAGTAACC TCTGTCCCTC CCGTCCCTGG ATCGTAAATG CTTCGATACC TGAATATGCT CGTTCTGCTG CGCTGAATTT CCAACTTTTG CCATTGGGTC 
TGTATTCGAT TCTAGATGTT TGTGATATCA ACTGTGTATA AATGATCTTT TGAAATATAC TTTTTTCTGC GGAGAAAAAA AAAA 

Retrieve as FASTA