Entry information : CnCcP02_JEC21
Entry ID 2329
Creation 2006-08-30 (Nenad Bakalovic)
Last sequence changes 2012-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-22 (Christophe Dunand)
Peroxidase information: CnCcP02_JEC21
Name CnCcP02_JEC21
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnCcP02_JEC21
start..stop
S start..stop
CnCcP02_grubiiH99 664 0 1..334 1..334
CnCcP02_R265 639 0 1..334 1..334
CgaCcP02 598 0 1..334 1..341
DcryCcP02 518 0 1..312 1..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1107477..1107507 31 N° 2 1107563..1107638 76 N° 3 1107692..1107731 40 N° 4 1107789..1107808 20
N° 5 1107865..1107889 25 N° 6 1107952..1108048 97 N° 7 1108110..1108334 225 N° 8 1108386..1108419 34
N° 9 1108472..1108567 96 N° 10 1108621..1108669 49 N° 11 1108728..1108833 106 N° 12 1108896..1109101 206
join(1107477..1107507,1107563..1107638,1107692..1107731,1107789..1107808,1107865 ..1107889,1107952..1108048,1108110..1108334,1108386..1108419,1108472..1108567,11 08621..1108669,1108728..1108833,1108896..1109101)


exon

Literature and cross-references CnCcP02_JEC21
Literature Loftus,B.J et al., The genome and transcriptome of Cryptococcus neoformans, a basidiomycete fungal pathogen of humans
Science (2005)
Protein ref. UniProtKB:   P0CP56
DNA ref. JGI genome:   NC_006687 (1107477..1109101)
mRNA ref. GenBank:   XM_571012
Cluster/Prediction ref. JGI gene:   4566 [Incorrect prediction] UniGene:   Fne.5152
Protein sequence: CnCcP02_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334
PWM (Da):   %s   36031.85  
PI (pH):   %s   5.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVKEGDYQALKEEIKKIMKQPGYDDGSAGPVLVRLAWHASGNFSLVHNGGSNGAGMRFPPSVDPANAGLHYAISFLLPLQSANSWISHADLWTLAGVTAIEAMGGPQIPWEPGRLDYESEQAAVEHRGDVSNRLPDGALGAAHIRDVFGRMGFSDQEIVALSGAHNLGRCHADRSGFDGPWVVNPTRFSNQYFKLLLRPIWKPRQWDGPFQYEAIVAGTRLMMLPTMALIEDPSFRPWVEKYAADQNLFFKDFANAFGKLIELGVDRDDTGFARLAKKAAEEGKPLDKTAPPAGDETCPVSGAVGGGVQRAAGGGGCPFMAMQNREAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 11 introns). Incorrect prediction from JGI. Strain="JEC21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAGTAAAAGAAGGAGACTACCAAGGTGGGAGAGTAAACCTAAGAATGGAGAAGGATTTCAATTGACTTTGTGTGATCAGCTCTGAAAGAGGAGATTAAGAAGATCATGAAGCA
GCCCGGGTACGACGATGGATCTGCTGGTCCCGTTTTGGTTAG
GTATGCCAGAATTGCATGAGTCATGATCCTTACATGCTTATCTGTACAAATAGACTGGCGTGGCATGCTTCTGGAAAC
TTTAGTCTGGTAGAA
GTAAGCTCATTGCTGGTCACGCTTTGTTAAAGGTCTTGGCTAACATGTGATTCATAGCACAACGGAGGTTCTAACGGGTAAGCAAGCATACAGTGAATCTCTTCA
CCTGGTCAAGCTAACATATGGAGTAAAGAGCTGGAATGAGATTCCCACCGGAAGTAAGCATCAATGAATCTTTCAGCTTGACGCGCGAAGAACAAGGCTAAACCAACTTCTCCAGTCTGT
TGACCCCGCAAATGCCGGTCTCCATTATGCCATATCGTTCCTTCTCCCGCTTCAGAGTGCCAACTCCTGGATCTCTCATGCGGACTTGTGGA
GTATGTTCCTCTCTCATCCTCAACTGTC
ATGGTTTCAATTAATCGACTCTCCTTTATTTAGCTCTGGCAGGAGTAACAGCCATCGAGGCTATGGGCGGTCCGCAAATCCCCTGGGAACCCGGAAGACTAGACTATGAATCTGAGCAAG
CTGCAGTTGAGCATCGAGGTGATGTGTCCAACCGTTTACCAGATGGAGCCTTGGGAGCAGCCCACATTAGGGACGTGTTTGGAAGAATGGGGTTCTCAGACCAGGAGATTGTAGCGCTCA
GTGGTGCTCATAACCTGG
GTGGGTGATGCGAGGTGGAAACATGTTTTCAATACTAATTCGACTCTTTAGGTCGTTGTCATGCGGACCGGAGTGGCTTTGATGGGTACCGGAAAATAGCCT
CTGTACGTGACGTTGGCTGATGATGAGCTATGCAGACCATGGGTCGTCAATCCAACTCGTTTCTCCAATCAGTATTTCAAACTTCTCCTCCGTCCCATTTGGAAACCCAGACAATGGGAT
GGACCATTCCA
GTAGGTGGACCTAAACCTAACTTCTATAATCTGTGCTGACATGAGGATCTCAGGTATGAAGCTATTGTAGCCGGCACAAGGCTCATGATGCTGCCAACAGACGTGGGCT
CAACTCTCATCTCCATGGCATCTGCATGATCCTTATTGACTCCTGTCATAGATGGCTCTCATTGAGGACCCATCATTCCGTCCATGGGTCGAAAAATACGCGGCAGACCAAAATCTCTTC
TTCAAAGATTTTGCCAACGCATTTGGTAAACTGATAG
GTATGCCTTCATCTTGATGCCCCTGCGACCGCTCGTTGCTGACTTCCTTAACAATCGCTTAGAGCTGGGAGTAGATAGGGACG
ATACAGGCTTTGCTCGACTGGCCAAAAAAGCCGCCGAGGAGGGCAAGCCGTTGGACAAGACTGCTCCTCCTGCCGGCGATGAGACTTGTCCCGTCTCTGGAGCAGTAGGCGGTGGCGTGC
AAAGAGCTGCTGGTGGTGGTGGCTGTCCCTTTATGGCGATGCAGAACAGGGAGGCAAAGTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAGTAAAAGAAGGAGACTACCAAGCTCTGAAAGAGGAGATTAAGAAGATCATGAAGCAGCCCGGGTACGACGATGGATCTGCTGGTCCCGTTTTGGTTAGACTGGCGTGGCAT
GCTTCTGGAAACTTTAGTCTGGTAGAA
CACAACGGAGGTTCTAACGGAGCTGGAATGAGATTCCCACCGGAATCTGTTGACCCCGCAAATGCCGGTCTCCATTATGCCATATCGTTCCTT
CTCCCGCTTCAGAGTGCCAACTCCTGGATCTCTCATGCGGACTTGTGGA
CTCTGGCAGGAGTAACAGCCATCGAGGCTATGGGCGGTCCGCAAATCCCCTGGGAACCCGGAAGACTAGAC
TATGAATCTGAGCAAGCTGCAGTTGAGCATCGAGGTGATGTGTCCAACCGTTTACCAGATGGAGCCTTGGGAGCAGCCCACATTAGGGACGTGTTTGGAAGAATGGGGTTCTCAGACCAG
GAGATTGTAGCGCTCAGTGGTGCTCATAACCTGG
GTCGTTGTCATGCGGACCGGAGTGGCTTTGATGGACCATGGGTCGTCAATCCAACTCGTTTCTCCAATCAGTATTTCAAACTTCTC
CTCCGTCCCATTTGGAAACCCAGACAATGGGATGGACCATTCCA
GTATGAAGCTATTGTAGCCGGCACAAGGCTCATGATGCTGCCAACAGACATGGCTCTCATTGAGGACCCATCATTC
CGTCCATGGGTCGAAAAATACGCGGCAGACCAAAATCTCTTCTTCAAAGATTTTGCCAACGCATTTGGTAAACTGATAG
AGCTGGGAGTAGATAGGGACGATACAGGCTTTGCTCGACTG
GCCAAAAAAGCCGCCGAGGAGGGCAAGCCGTTGGACAAGACTGCTCCTCCTGCCGGCGATGAGACTTGTCCCGTCTCTGGAGCAGTAGGCGGTGGCGTGCAAAGAGCTGCTGGTGGTGGT
GGCTGTCCCTTTATGGCGATGCAGAACAGGGAGGCAAAGTTATAA

Retrieve as FASTA