Entry information : AtPrx67 (At5g58390 / PER67 / AtperoxP67 / ATP44)
Entry ID 233
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx67 (At5g58390 / PER67 / AtperoxP67 / ATP44)
Name (synonym) AtPrx67 (At5g58390 / PER67 / AtperoxP67 / ATP44)
Class Class III peroxidase    [Orthogroup: Prx057]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type Stamen Abscission Zone
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx67
start..stop
S start..stop
AlyPrx67 588 0 1..316 1..316
AhalPrx62 588 0 1..316 9..324
CrubPrx103 560 0 1..316 1..316
CagraPrx29 559 0 1..316 9..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23601047..23601244 198 N° 2 23600757..23600948 192 N° 3 23599755..23600315 561  
complement(join(23599755..23600315,23600757..23600948,23601047..23601244))


exon

Literature and cross-references AtPrx67 (At5g58390 / PER67 / AtperoxP67 / ATP44)
Literature REFERENCE 1 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21
Protein ref. UniProtKB:   Q9LVL2
DNA ref. Phytozome 11:   Chr5 (23601244..23599755)
mRNA ref. GenBank:   NM_125225
Cluster/Prediction ref. Phytozome Gene 11:   19666534 UniGene:   At.29283
Omic ref. AtProteome:   At5g58390 ATTED-II:   At5g58390 e-FP Browser:   At5g58390 ePlant:   At5g58390 Genevestigator:   At5g58390 TAIR:   At5g58390
Protein sequence: AtPrx67 (At5g58390 / PER67 / AtperoxP67 / ATP44)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (297)
PWM (Da):   %s   34571.81 (32451.7)  
PI (pH):   %s   10.38 (10.40) Peptide Signal:   %s   cut: 20 range:20-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLKVVLLMMIMMLASQSEAQLNRDFYKESCPSLFLVVRRVVKRAVAREPRMGASLLRLFFHDCFVNGCDGSLLLDDTPSFLGEKTSGPSNNSVRGFEVIDKIKFKVEKMCPGIVSCADILAITARDSVLLLGGPGWSVKLGRRDSTTANFAAANSGVIPPPITTLSNLINRFKAQGLSTRDMVALSGAHTIGRAQCVTFRNRIYNASNIDTSFAISKRRNCPATSGSGDNKKANLDVRSPDRFDHGFYKQLLSKKGLLTSDQVLFNNGPTDSLVIAYSHNLNAFYRDFARAMIKMGDISPLTGSNGQIRQNCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2), 3 cDNA and 2 EST
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATATATATAT ATATATATAT ATATATATAT ATATGCGTGG TTCAACTTTT CAACAATCCA CGTGAGATAA TTTTATCTTT TTTGTTTGTT CTTATACATT TGATTGAAGT AATTGGGAGA  GAGCTAGAAT GCAAATTGTA AGTGATAGAC AACTCCACCT AGTAATAGTT CGTTTGTTAA CCTCTCACCA TCAGTTTTTT TTTTTTTTCC TTTCATGTTA AAAGAAATCT ACTTTTATTT  CCCCAACCTT TGAAAATTCA ACTTTTTACT TTTTGCAAGA CAAACGCACT GTTTTTCCTC TGTGACTTAA TAAAAAATTC GAGGTGTTTA TCTTGAATTT GAGTTGTAGG ACGTAGATAA  TTGATTTTGT CACGAGTATA TATGATCAAC GATGATATTA TTCGTTTTTA GTGGCCTAGT TTCTCATCTG ATAAACTTTT CAAACAACAT GTCATATAGT TGTTGCGCCA TAATCAGTAA  TTCTTTCTCT ATCGGTGGGT GTGGGAACCA CAAACGGATC AAACTTATAA GTTATATTAA TTAGAGTCTG AACGAAAAAA ATCGCGTAGG TTATATATTA TTTCCATTCT CTAACGGTTA  ATTTAGTGGC GGCCGGTGTT AGACATGTTT TTGTTTTCTA GGGTTGGCAA GTACAATAAC AATACATGTT CTGGAGTGAA GTGAAGTAGT TGTCAAATAG AATTTTAGTT TTGAACAAAT  TAATCCTTGA TACTTTTTTA TGTAACTATT AATTATATGA TATAAATAAT GAAAGGTGAT CAAGGGCTGG GAATGTCGTG GTTGCATGCA TGGAACTTGG AAGGTCAGCT GCTTCTGCCA  AACTTATTCC CCGCTCCCCC AGTGATATGA CCTATCTGCC CTCACATTCT TTCAATCAGA TCCTCTATGT CCACAATTAT TGTATCAAAC AAAACTGTTG CCAGATGGAA AACCGAGATT  GATCGAGCAG AATCACTAAC CGAGATATAT CAATCAACGT TGTAGAAAGT CCTAGCAGAC ATTGTAGATG TAGGTAGTTT TGAATATATT GGTTATATTT CTAGCTAATG AATGCATTTT  GTAACTTCAT ATTTACAAGA GTTCAATACA ATTATTCCAC AAGTCCTTTC GTATTCTTAG TCTCATCAAC TTATCAATAT ATCATATCCT TAACACATGC TCATGATGAA TTTGGTTTTA  CCCAAAAACC GGTCTAGTTA ATCTGATCCG AAATTAATTT GATCCATCCA TCACCTTAAG AGAACACATA TTAGAAATCC TACACTGAAA ACAGAATGAG ACCAAGGTAA TTTATCAATG  GATATGGATC AAACCCACTT ACCAGCAATA GGTTTTGATA GGAAACCCTT CAAATTTAGC ATGTAAAACT TTAGATCGAA CCACTTTGGA TTCAAATTAG ATGGCACATA TTCTACTACT  TTAATATCAT GTAAAGATTC ATTTGCTTTC AAATCAAAAC CAATGTGTGG ATTGATTAGT TATTTTATTA TCACAACTTT GAATTATAAT TACTGTCATC TATCTATAAC ATAAACTAAA  ATAATAATGT ACATTACTAT ATATGTTTAT TATATAGTAT ATCGCAAATC TTGATATGGT TATGGATATA TCAAGTTTAA TAATGTATGC TCACCTTAAA ACGTATATAC TCCCGACGAA  TAATGAACAT TAGAGTTTTA ATTTGTATAA TAAGATATGC TTGGTAGAAA ACAAAAAAGG GAAATGTGCT GAAAAAAGGG AAATGTAAAC ATGCATGAAT ATGGTAAAGG TGGCGTAATT  AAGGAGTAAG GACCCAGTAA TATAGTGGAT ATTCGAGAAA AACTTTTCTA CGTGAACAAA AATAACCTAC GTGTAAGTTA TCCTCTCTAT AAAGCCCTCA TCAAGTCTCT GAGTCCTTCA 
ACGACTCATA ACTCATAGCT ATATCTTGTC TTAAAAAGAA GAAGCAAAGA GAATTAGTGG AGTACGATAA GCAGAGAAGT 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTCTCT TTTATATTAT CCCAAGCCCA TTGAGCTCAA TAATCACCTC TTCGTCAACT GTTTTTTCAT GTGCATTCCC CTTCTTCGTC AACTGTTAAA ATACATCTTC ATTATATAAA  AAACAATAAA CACGTAAAAG TTTGTGACTA TGCAGTTTTC CATTATAAAT TACTGTCTAT ATTCTCTTCT TATTTTTTTT TTTTTTTTTT TCTCTTCTTA CTTTGGCTGA TTGAAAGAAA  TAAAACTTTT AAATTTAGTT GAGTAGATGA TTTGTTATAA ACTCTATGCT ACGATTTTTC AAATATTAGT AGATAAAATA TCATTAAAAA AAAAAATGGT GAGCAAACTA TCATAAAAAT  ATATGATGGC AAAATGTGAG CCGTCGGATG AAAAGTGAAT AGGCGAATGA GAGGACAAGT GTAAAAAGTC ATAAGGTAGA CAAGGACACA GAGGAACAAG TGGCCTCTGC TCTTCTGCCT  CAATTAAAAA ATTATTTTTA TTTTTGATGT GCGTGGACCG CCAATGACGT TTAACTTCGT TTTCATCTCT TCTTCTTCTT CTTCTTCCGT CTTCTCCTCC ATTTTTGTTG GTAAACCCAG  AAAGAAATAA GGAAGAGAAG GGGCCTTTAG GGGCGGATAG AGAGATCTAC ACGTCTTTCT ACTAGATCTC GGATTCATTC CCAGAATCCT CTTTCCTCAC CGGTGATTGT CTTGATCATA  TATGTTTTGT TTTCTCCTTG CGAATTGTTG ATTACATGTT GAAATTTAGG GTTCTCTGAT TGCCGATCTA TGCTTTTTCT CTTTAATATA GAGGTAATGC GGTAATGGGG GAGAATTATA  TAACCTGAAT GATCGGTTCT GGTTTAGGGC TTTAGTGGTT TGAGAATTTG TGTGTGTGTT TTGATTGATG ATTGCGTTTT GACTCGTGAT CGATACATAT AATTGAGTTT AGATTTGATC 
GATACACTGA TTGTTGTTGG AAGTAGATCT CATTGCTTTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTAAAGGTGGTGTTGTTGATGATGATAATGATGTTGGCGTCACAGTCCGAGGCTCAGCTGAACCGTGACTTTTACAAGGAAAGCTGTCCATCATTGTTCCTTGTCGTGAGACGAGTC
GTGAAACGGGCCGTGGCCAGAGAGCCTCGCATGGGTGCTTCTCTCCTTCGTTTGTTCTTCCATGATTGTTTTGTCAAT
GTAAGGCACTTTTTTTCAATGCAAAAACGAAGCATGCTTTGT
ATGTTCCCATGAATTACTCCTAAAACTTAGTAAATGCTAAGCATATGATTTGATAGGGGTGTGACGGATCCTTACTGTTGGATGACACACCGTCTTTTTTGGGAGAGAAAACCTCAGGAC
CCAGCAATAACTCTGTGAGGGGGTTCGAAGTGATCGACAAAATCAAGTTTAAGGTTGAGAAAATGTGCCCGGGCATCGTCTCATGCGCAGACATTCTAGCCATCACTGCTCGGGACTCCG
TTCTCCTC
GTTAGCACCTCTACCCTTTTACTCTTTGTCATGTCTTACATAGATGCATGTAATAATTGTTGAATGGTTAAGTGGCTTAGTGATTCGGATTCATTTATTTTACCTAGCTAGA
ACCAGAGTTCGAATCTTCTAGTAATTAATCAATTGTCCCTTTTCAAAACTTAAAAAGAAGGGTAAAATTGTAGTGCAACTTGCATCTTTTTCCTTCTGATTTTCTTGTAAATCATTGATT
TTCTAAATCATTCTCACATACATCTAGCCAAAATAGCATAAATCTACCATTACTTTACGAATTCCTAACAAGATACTTTTACATTTTGGTCGATTTTACAGCATATGAACACGGACCAAT
TTTTGTTTTTTGTTTTTCCCTTTGTTACAAACCCTTCAGCCGACCAACATTTATCTAAATGTTTAACACTTCTTAATATGACTAAACAGCTAGGTGGACCGGGGTGGAGCGTGAAACTTG
GAAGAAGAGACTCTACGACGGCGAACTTCGCGGCCGCGAACTCCGGAGTCATCCCTCCTCCGATCACTACCCTTAGCAACCTCATAAACCGTTTCAAAGCACAAGGTTTGTCCACACGTG
ACATGGTCGCCCTCTCTGGTGCTCACACCATTGGACGAGCCCAATGTGTTACATTCAGAAACCGAATCTACAACGCAAGCAATATCGACACCTCTTTCGCCATCTCTAAACGGAGGAACT
GTCCTGCCACCAGTGGCTCCGGAGACAACAAGAAAGCCAATCTTGACGTCCGCTCTCCCGATAGGTTCGACCACGGCTTCTACAAGCAACTTCTGAGCAAAAAAGGTTTGCTTACGTCAG
ACCAAGTCCTCTTTAATAATGGTCCTACCGACTCGCTCGTCATAGCTTACAGCCACAATCTCAATGCCTTCTACCGCGACTTTGCAAGGGCAATGATTAAGATGGGAGACATCAGCCCCC
TCACCGGATCCAATGGTCAGATCCGCCAAAACTGTCGGAGGCCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTAAAGGTGGTGTTGTTGATGATGATAATGATGTTGGCGTCACAGTCCGAGGCTCAGCTGAACCGTGACTTTTACAAGGAAAGCTGTCCATCATTGTTCCTTGTCGTGAGACGAGTC
GTGAAACGGGCCGTGGCCAGAGAGCCTCGCATGGGTGCTTCTCTCCTTCGTTTGTTCTTCCATGATTGTTTTGTCAAT
GGGTGTGACGGATCCTTACTGTTGGATGACACACCGTCTTTT
TTGGGAGAGAAAACCTCAGGACCCAGCAATAACTCTGTGAGGGGGTTCGAAGTGATCGACAAAATCAAGTTTAAGGTTGAGAAAATGTGCCCGGGCATCGTCTCATGCGCAGACATTCTA
GCCATCACTGCTCGGGACTCCGTTCTCCTC
CTAGGTGGACCGGGGTGGAGCGTGAAACTTGGAAGAAGAGACTCTACGACGGCGAACTTCGCGGCCGCGAACTCCGGAGTCATCCCTCCT
CCGATCACTACCCTTAGCAACCTCATAAACCGTTTCAAAGCACAAGGTTTGTCCACACGTGACATGGTCGCCCTCTCTGGTGCTCACACCATTGGACGAGCCCAATGTGTTACATTCAGA
AACCGAATCTACAACGCAAGCAATATCGACACCTCTTTCGCCATCTCTAAACGGAGGAACTGTCCTGCCACCAGTGGCTCCGGAGACAACAAGAAAGCCAATCTTGACGTCCGCTCTCCC
GATAGGTTCGACCACGGCTTCTACAAGCAACTTCTGAGCAAAAAAGGTTTGCTTACGTCAGACCAAGTCCTCTTTAATAATGGTCCTACCGACTCGCTCGTCATAGCTTACAGCCACAAT
CTCAATGCCTTCTACCGCGACTTTGCAAGGGCAATGATTAAGATGGGAGACATCAGCCCCCTCACCGGATCCAATGGTCAGATCCGCCAAAACTGTCGGAGGCCCAACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACGACTCAT AACTCATAGC TATATCTTGT CTTAAAAAGA AGAAGCAAAG AGAATTAGTG GAGTACGATA AGCAGAGAAG TATGTTAAAG GTGGTGTTGT TGATGATGAT AATGATGTTG  GCGTCACAGT CCGAGGCTCA GCTGAACCGT GACTTTTACA AGGAAAGCTG TCCATCATTG TTCCTTGTCG TGAGACGAGT CGTGAAACGG GCCGTGGCCA GAGAGCCTCG CATGGGTGCT  TCTCTCCTTC GTTTGTTCTT CCATGATTGT TTTGTCAATG GGTGTGACGG ATCCTTACTG TTGGATGACA CACCGTCTTT TTTGGGAGAG AAAACCTCAG GACCCAGCAA TAACTCTGTG  AGGGGGTTCG AAGTGATCGA CAAAATCAAG TTTAAGGTTG AGAAAATGTG CCCGGGCATC GTCTCATGCG CAGACATTCT AGCCATCACT GCTCGGGACT CCGTTCTCCT CCTAGGTGGA  CCGGGGTGGA GCGTGAAACT TGGAAGAAGA GACTCTACGA CGGCGAACTT CGCGGCCGCG AACTCCGGAG TCATCCCTCC TCCGATCACT ACCCTTAGCA ACCTCATAAA CCGTTTCAAA  GCACAAGGTT TGTCCACACG TGACATGGTC GCCCTCTCTG GTGCTCACAC CATTGGACGA GCCCAATGTG TTACATTCAG AAACCGAATC TACAACGCAA GCAATATCGA CACCTCTTTC  GCCATCTCTA AACGGAGGAA CTGTCCTGCC ACCAGTGGCT CCGGAGACAA CAAGAAAGCC AATCTTGACG TCCGCTCTCC CGATAGGTTC GACCACGGCT TCTACAAGCA ACTTCTGAGC  AAAAAAGGTT TGCTTACGTC AGACCAAGTC CTCTTTAATA ATGGTCCTAC CGACTCGCTC GTCATAGCTT ACAGCCACAA TCTCAATGCC TTCTACCGCG ACTTTGCAAG GGCAATGATT  AAGATGGGAG ACATCAGCCC CCTCACCGGA TCCAATGGTC AGATCCGCCA AAACTGTCGG AGGCCCAACT GAATGATTCT CTTTTATATT ATCCCAAGCC CATTGAGCTC AATAATCACC  TCTTCGTCAA CTGTTTTTTC ATGTGCATTC CCCTTCTTCG TCAACTGTTA AAATACATCT TCATTATATA AAAAACAATA AACACGTAAA AGTTTGTGAC TATGCAGTTT TCCATTATAA 
ATTACTGTCT ATATTCTCTT 

Retrieve as FASTA