Entry information : MgrCcP01
Entry ID 2342
Creation 2005-10-27 (Nenad Bakalovic)
Last sequence changes 2005-10-27 (Nenad Bakalovic)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: MgrCcP01
Name MgrCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Magnaporthaceae Magnaporthe
Organism Magnaporthe grisea (Pyricularia grisea)    [TaxId: 148305 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MgrCcP01
start..stop
S start..stop
FoCcP01 473 3e-170 2..299 13..310
GmoCcP01 471 2e-169 2..298 13..309
GzCcP01 468 6e-168 3..292 14..303
CparCcP02 465 9e-167 2..296 8..302
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2842389..2842501 113 N° 2 2841514..2842303 790  
complement(join(2841514..2842303,2842389..2842501))


exon

Literature and cross-references MgrCcP01
Literature Birren,B. et al., The genome sequence of Magnaporthe grisea, unpublished
Protein ref. UniProtKB:   A4R606
DNA ref. JGI genome:   Supercontig_6.12 (2842501..2841514)
mRNA ref. GenBank:   XM_366148
Protein sequence: MgrCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   300
PWM (Da):   %s   32865.5  
PI (pH):   %s   5.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKPGDFDAVRKDIVSLLDQPEYDDGSAGPVLVRLAWHSAGTYDKSTDTGGSNGAGMRYEAEGGDPANAGLQNARQFLEPVKARHPWITYADLRTLAGVVAVRAMGGPEIPWRAGRTDFADDSRVPPRGRLPDATQGAAHVRDIFYRMGFDDREIVALSGAHSLGRCHPANSGFEGKWVNNPTRFSNQYFRLLLSEDWREKTVAGTGLKQFVAVDEVTGDELMMLPTDLSLTSDPVFARWVKVYRDDQDLFFADFAKVFDKLMELGIKRDAEGKVINKENVEGGYVSAPKKQGKIASKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo IV).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCAAACCTGGCGATTTCGACGCTGTCCGCAAGGACATCGTGTCGCTGCTGGACCAACCAGAATATGATGACGGAAGCGCTGGTCCCGTTCTCGTCCGTCTTGCCTGGTAAGTT
GTATCCATTCCCTCCTCCATCCCCACGTAGATCTTCCGCACGACTAATGCATTCACAACAACCCCCCCCCACTAAAAGGCACTCTGCCGGGACCTACGACAAGTCGACAGACACCGGCGG
CTCCAACGGCGCCGGGATGCGCTACGAGGCCGAGGGCGGCGACCCAGCCAACGCAGGCCTGCAAAACGCGCGGCAGTTCCTCGAGCCCGTCAAGGCGCGCCACCCGTGGATCACGTACGC
GGACCTGCGGACGCTGGCCGGCGTGGTGGCCGTGCGGGCCATGGGCGGACCCGAGATCCCCTGGCGGGCCGGCCGGACCGACTTTGCCGACGACAGCAGGGTGCCGCCGCGGGGCAGGCT
GCCGGACGCGACGCAGGGCGCGGCGCACGTCCGCGACATCTTTTACCGCATGGGCTTCGACGACCGCGAGATCGTGGCGCTGTCCGGCGCGCACTCGCTCGGCCGCTGCCACCCGGCCAA
CTCGGGCTTCGAGGGCAAGTGGGTCAACAACCCGACCAGGTTCTCGAACCAGTACTTCCGCCTGCTGCTCAGCGAGGACTGGCGGGAGAAGACTGTGGCCGGGACGGGTCTGAAGCAGTT
TGTGGCCGTCGACGAGGTCACGGGCGACGAGCTGATGATGCTGCCGACGGACCTGTCGCTCACGTCCGATCCGGTGTTTGCCAGGTGGGTCAAGGTGTATCGGGATGACCAGGACCTGTT
CTTTGCGGATTTCGCAAAGGTTTTTGACAAGCTGATGGAGTTGGGCATCAAGAGGGATGCAGAGGGGAAGGTGATCAACAAGGAAAATGTTGAAGGGGGCTACGTCAGTGCTCCTAAAAA
GCAAGGCAAGATTGCATCCAAGTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCAAACCTGGCGATTTCGACGCTGTCCGCAAGGACATCGTGTCGCTGCTGGACCAACCAGAATATGATGACGGAAGCGCTGGTCCCGTTCTCGTCCGTCTTGCCTGGCACTCT
GCCGGGACCTACGACAAGTCGACAGACACCGGCGGCTCCAACGGCGCCGGGATGCGCTACGAGGCCGAGGGCGGCGACCCAGCCAACGCAGGCCTGCAAAACGCGCGGCAGTTCCTCGAG
CCCGTCAAGGCGCGCCACCCGTGGATCACGTACGCGGACCTGCGGACGCTGGCCGGCGTGGTGGCCGTGCGGGCCATGGGCGGACCCGAGATCCCCTGGCGGGCCGGCCGGACCGACTTT
GCCGACGACAGCAGGGTGCCGCCGCGGGGCAGGCTGCCGGACGCGACGCAGGGCGCGGCGCACGTCCGCGACATCTTTTACCGCATGGGCTTCGACGACCGCGAGATCGTGGCGCTGTCC
GGCGCGCACTCGCTCGGCCGCTGCCACCCGGCCAACTCGGGCTTCGAGGGCAAGTGGGTCAACAACCCGACCAGGTTCTCGAACCAGTACTTCCGCCTGCTGCTCAGCGAGGACTGGCGG
GAGAAGACTGTGGCCGGGACGGGTCTGAAGCAGTTTGTGGCCGTCGACGAGGTCACGGGCGACGAGCTGATGATGCTGCCGACGGACCTGTCGCTCACGTCCGATCCGGTGTTTGCCAGG
TGGGTCAAGGTGTATCGGGATGACCAGGACCTGTTCTTTGCGGATTTCGCAAAGGTTTTTGACAAGCTGATGGAGTTGGGCATCAAGAGGGATGCAGAGGGGAAGGTGATCAACAAGGAA
AATGTTGAAGGGGGCTACGTCAGTGCTCCTAAAAAGCAAGGCAAGATTGCATCCAAGTTATAA

Retrieve as FASTA