Entry information : AtPrx69 (At5g64100 / PER69 / AtP69)
Entry ID 235
Creation 2006-02-07 (Filippo Passardi)
Last sequence changes 2015-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx69 (At5g64100 / PER69 / AtP69)
Name (synonym) AtPrx69 (At5g64100 / PER69 / AtP69)
Class Class III peroxidase    [Orthogroup: Prx063]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Seedlings
Inducers Cold stress
Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx69
start..stop
S start..stop
AlyPrx69 605 0 1..331 1..332
CagraPrx72 592 0 1..331 1..331
CrubPrx53 584 0 1..331 1..331
ThPrx69 573 0 1..331 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25651637..25652062 426 N° 2 25651335..25651494 160 N° 3 25650824..25651233 410  
complement(join(25650824..25651233,25651335..25651494,25651637..25652062))


exon

Literature and cross-references AtPrx69 (At5g64100 / PER69 / AtP69)
Literature REFERENCE 1 Kim BH, Kim SY, Nam KH. Genes encoding plant-specific class III peroxidases are responsible for increased cold tolerance of the brassinosteroid-insensitive 1 mutant. Mol Cells. 2012 Dec;34(6):539-48.
Protein ref. UniProtKB:   Q96511
DNA ref. Phytozome 11:   Chr5 (25652062..25650824)
mRNA ref. GenBank:   NM_125806
Cluster/Prediction ref. Phytozome Gene 11:   19673191 UniGene:   At.25608
Omic ref. AtProteome:   At5g64100 ATTED-II:   At5g64100 e-FP Browser:   At5g64100 ePlant:   At5g64100 Genevestigator:   At5g64100 TAIR:   At5g64100
Protein sequence: AtPrx69 (At5g64100 / PER69 / AtP69)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (308)
PWM (Da):   %s   35542.57 (33094.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.73 (9.53) Peptide Signal:   %s   cut: 24 range:24-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRGYNLLFVLVTFLVLVAAVTAQGNRGSNSGGGRRPHVGFYGNRCRNVESIVRSVVQSHVRSIPANAPGILRMHFHDCFVHGCDGSVLLAGNTSERTAVPNRSLRGFEVIEEAKARLEKACPRTVSCADILTLAARDAVVLTGGQRWEVPLGRLDGRISQASDVNLPGPSDSVAKQKQDFAAKTLNTLDLVTLVGGHTIGTAGCGLVRGRFVNFNGTGQPDPSIDPSFVPLILAQCPQNGGTRVELDEGSVDKFDTSFLRKVTSSRVVLQSDLVLWKDPETRAIIERLLGLRRPSLRFGTEFGKSMVKMSLIEVKTGSDGEIRRVCSAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3), 6 cDNA and 113 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTTTCAAG ATGAAGTTAA ATTTCATAAA ATAGTATATT TGGTATCACG AGATTTTCGC CAATTTCCGG CAGAAAACTG GGTGATGAAT ATTAGTCTCA TCTCATATTG TATAATGTAC  ATGTACGTGC TCGGTGATGG GTGAAATTTG TCCTCTCCGT CTCTGGTTTT TATAACTAGA CCGATATTAA TTAAAATTAT GTGTCCTGTA TAAAGTTATC GTTCTTAATT ATACTTGAAA  TGTGAATATT GGTTCCTTTC TTTATCTTAA TCTATAACTC TTAACTGTAA AGTGAAATTT GAATAAGACT TTTACAAAAA ACATAAAATA CAATTAGTGA AGTCAATCAA AGTTGGAACG  ATTCAGTTTG AATTCACTGT TCGAAATGAA TCTAATCATT GGTGGAAAAT GATTAAAGGG ATAATAGTAA GGATAATTAT ATATCAGTGG TTGACTTTGA CAATAAAGAA AAAGACAAGT  CAATGATATT ATGCCTTCGA AGTTGTCTCT TGGTGGTTTC ATTAAACAAG ACATCCTCAT TCCTCAGTCA AAATTATATG CTCTTTTTTT TTTTACCCAC CGACTATCTA GTAAACATTA  AACAAGACAT CAAGCTTATC TCTTTACAGC TTTGATAAAT TCGTAACAGT TTTGACAAAA AAAAATAAAA AATACTAGTT TCATACGGTT TTCATTAATT CGTAACAGTT TTGTTTTTAG  TTAATATTTT TCAAAATGGT AATTTCTCTG CAGCACACTT TTAAAGTCGA ATTCATTTAC AAGTTGTGAT TTAGCGGTCA CACACGTTTT TCCGTCATCA GAAAATTACA CATACACATA  CATATGCATG CCAGCTGCAA GTATATCATA TAATGTTATA CTGTATTACT TTGTAACTCG TTAATTACTT TAATTAAGGG AACTGAATAA CTAACTACAG CCATCACTAT ACATATTCTC  TTTGTTTTGT ACTTTCCCCA TGCAGAAACC TACTTAGTCT ATTATTGTTC AATGGTTCAA TTTTTTTATT TTATTTGTAT GGTTCAAATT TTCCATGGCG GTGAATACTT TAATGTTTTT  TATCCTTCAA AGAATAAATA GTAGTATTAT ATATTGGCTA ATCCAAAAGA GTAGAGAAAC AAATATACCA TTATAATAGA CGATTTGATC ATTTTAAAAA GTCAACTATG CCCGTTACAT  TTTCATCATC CCTAACGTTC TGACCAAAAC TTTGTAATCT ATATTATCGC CACGTAACTC ATTGATCTAA TCTATGAAGC AATATTTGAC CCTAATAAAA CATCACTATT GTGGTACCAA  CTGGTATCGG AGATTTTACT TTTTAAGCCA ACTGATTAAT ATTTTGTCAC GAATAATTTG CGTTTATATT TTTCAAAATC ACATTTTAGT TTTTACAAAA AAAAAATCAC ATTTTAGTGT  TTCTTGAATA GATTTGATCA CTTTTCTTAA TGTATCGTTC ATTTTTTTCC AATTAATCAA CTGCAATTTT GGCCGATTTA GCTACATGTC GAAAAACACT AATCGATTTT TCTTCCAGAG  TTTTAAGATG CTTTACGTTT ATACCATTCA CCTTATATTA GTTTTCATTT TGTTTTCGAC CAAAACTATT GATCCAAATT ATTATAGCTA GGTACGATTT GAACAAACTT TGATTCTCTT  ACCAATCATC TACAACTTAA AACCAAGATA GCTTCGCTCA AAAAGAAAAA AATAATGACA ACATGTATAA TACATATATG TTCAATGGAC CGACTCATCT ACACTGTTAT TCAAACTAAT  TATTTTATAA ATGATTACTA AATCAGCTTA TTAAATTCCC ATAATTTCTG CGTCGTGTGC CGAAGTTGCT CGTTACAATT GTTATTCCCA CAACTTTTTT TGCCTATATA TACAAACCCT 
TTAACATCAA ACTCAAAACA CACAACAAAC ACAACTTCTA CAAGACTCAA ATAGTTTCTA TTTAATTACT AAAAAGAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATTTAAAAA AACACAAATG TGAGCTTTGT TTTTCATTTA TGAATTCGTT AATTAATAAT CACTTGTTTT AAATAAAAGC TTGCTACAGC ATTTTGTGGT CGATGGTTAC GTTTTGATTT  TCAAGTGTAA GATTGTACTT GTAAACAAAA AATGTATTAT ATAAAAGTGT TATTTGTTTC TTCACTCGTG TACGGAATAT GTTTAAATGA ACGAACTTTT CAAGGAAAAA GTGTTGAATA  TGTTTGATTA ATGGAAGCTT ATCTATTATC GGAGTTGATA TTTGATTATC TGAAAAGATT AAATATACAT ATGATGTTGT TTGGACAATT CATGGATTAG AGAAGTTAGG ACCTCTTGTG  GATTCCAGCG AAGTTACAAT CGCTAATCAT TATCCTAAGT TTGTATTTAT CGAAAATGCC TAATTAGGAA ACGACTTTTT TTGTTTGGGA CAAAGAAAAC AAATTTCTAA ATATGTTTTT  TTTCTTCTAA ATAATCATTA ATTCATTATG TATCACAAAT TCACAATGAT GTTTTAACTT ACTACTAATA CAAGATTTGT GTGTTTTATT TTGAATTGCG GTTACGCTAT CATATTCAAT  GCTATCATCC CCACTTAAAA AATCGAAAGG AATCACTTAT GGCTATCCAA TTTGTGTGAA TTGATTCATA GTCAAAATAG CCAGGCTGAT GCTTTCGCAA AGGAGGCTCT CCTCCTCCCC  TGTTTGGAAC CCTAACTTTT TCGAATGAGA TGAATTGATT TTGCCCCAAA AAAAAAAAAT CAACAATAAA ACCAAGAATA TGCATCATCA AAGTTTTCTG GAATATATTA GATCGATTGA  GAATGATGTA TACTGATCTT TGGTTCGCTT TTGTGCCAAA ATAAGTTAGT CAAAAGAGGT CAACATGATC ATAAATTGAC GAACGAATGA TCGTAGTTTC TTCCTTCCAA ATTAAAAATT 
CGGGCTTTTA GGGTTTCATT AGCAATTGGG CCATTTCTAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTGGTTACAATTTGCTATTCGTTCTAGTAACGTTTTTAGTATTGGTTGCAGCTGTAACCGCACAAGGGAACCGTGGCTCAAACAGCGGTGGTGGTCGAAGACCACATGTTGGG
TTTTATGGGAATAGATGCCGAAACGTAGAGTCTATTGTGAGATCTGTAGTTCAGTCTCATGTCCGGTCTATCCCGGCTAATGCACCTGGAATTTTGCGAATGCATTTCCACGATTGCTTT
GTCCATGGCTGCGATGGCTCGGTTCTCCTCGCTGGTAACACCTCAGAGAGAACCGCAGTTCCGAACCGTTCATTGAGAGGGTTCGAAGTTATTGAAGAAGCTAAGGCTCGGCTTGAGAAG
GCTTGTCCTCGTACCGTTTCTTGTGCTGATATTCTCACCCTTGCAGCCCGAGACGCCGTCGTTTTG
GTAATATACTGAAATTATTACATGCATTACATATTTCATTCGATTTCTTACTTT
CTTATTTATGTGTGTATTTCACATGATTAAAATATATAACATATATATATGGTCGTGTTTAGCGGTAATTTAATATTGGTTTATGCAGACCGGTGGACAACGCTGGGAAGTGCCCTTGGG
ACGTCTCGACGGCCGAATCTCGCAAGCCTCAGACGTGAACTTGCCCGGACCAAGCGACTCCGTTGCTAAGCAGAAGCAAGACTTCGCTGCTAAAACTCTCAACACATTAGACCTCGTGAC
TCTTGTTG
GTACGTTGTCATTGCATATGGTTTAAATGTAACACTTTGTAAGTTATTCAGAAAATAATTTCCTAGTAGCTAATTTCTAAGTGAGTTTTGGTTTTGACCAGGCGGACACACA
ATAGGAACTGCTGGCTGCGGTCTAGTAAGGGGAAGGTTCGTTAACTTCAACGGCACAGGACAACCTGACCCATCAATCGACCCGAGTTTTGTGCCGCTGATTCTGGCTCAGTGCCCTCAA
AATGGAGGCACCCGAGTGGAGTTAGACGAGGGAAGTGTTGACAAGTTTGACACATCGTTCCTAAGGAAGGTGACGTCAAGTCGCGTGGTTCTCCAATCCGATCTAGTCCTATGGAAGGAT
CCCGAGACCCGAGCCATCATTGAACGTTTATTAGGATTACGCCGACCATCCTTGAGGTTCGGAACCGAGTTCGGGAAGTCGATGGTCAAAATGAGTCTCATAGAAGTTAAGACTGGATCA
GATGGGGAGATTCGTCGGGTTTGTTCCGCCATCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTGGTTACAATTTGCTATTCGTTCTAGTAACGTTTTTAGTATTGGTTGCAGCTGTAACCGCACAAGGGAACCGTGGCTCAAACAGCGGTGGTGGTCGAAGACCACATGTTGGG
TTTTATGGGAATAGATGCCGAAACGTAGAGTCTATTGTGAGATCTGTAGTTCAGTCTCATGTCCGGTCTATCCCGGCTAATGCACCTGGAATTTTGCGAATGCATTTCCACGATTGCTTT
GTCCATGGCTGCGATGGCTCGGTTCTCCTCGCTGGTAACACCTCAGAGAGAACCGCAGTTCCGAACCGTTCATTGAGAGGGTTCGAAGTTATTGAAGAAGCTAAGGCTCGGCTTGAGAAG
GCTTGTCCTCGTACCGTTTCTTGTGCTGATATTCTCACCCTTGCAGCCCGAGACGCCGTCGTTTTG
ACCGGTGGACAACGCTGGGAAGTGCCCTTGGGACGTCTCGACGGCCGAATCTCG
CAAGCCTCAGACGTGAACTTGCCCGGACCAAGCGACTCCGTTGCTAAGCAGAAGCAAGACTTCGCTGCTAAAACTCTCAACACATTAGACCTCGTGACTCTTGTTG
GCGGACACACAATA
GGAACTGCTGGCTGCGGTCTAGTAAGGGGAAGGTTCGTTAACTTCAACGGCACAGGACAACCTGACCCATCAATCGACCCGAGTTTTGTGCCGCTGATTCTGGCTCAGTGCCCTCAAAAT
GGAGGCACCCGAGTGGAGTTAGACGAGGGAAGTGTTGACAAGTTTGACACATCGTTCCTAAGGAAGGTGACGTCAAGTCGCGTGGTTCTCCAATCCGATCTAGTCCTATGGAAGGATCCC
GAGACCCGAGCCATCATTGAACGTTTATTAGGATTACGCCGACCATCCTTGAGGTTCGGAACCGAGTTCGGGAAGTCGATGGTCAAAATGAGTCTCATAGAAGTTAAGACTGGATCAGAT
GGGGAGATTCGTCGGGTTTGTTCCGCCATCAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACACAACAAA CACAACTTCT ACAAGACTCA AATAGTTTCT ATTTAATTAC TAAAAAGAAA AATGGGTCGT GGTTACAATT TGCTATTCGT TCTAGTAACG TTTTTAGTAT TGGTTGCAGC  TGTAACCGCA CAAGGGAACC GTGGCTCAAA CAGCGGTGGT GGTCGAAGAC CACATGTTGG GTTTTATGGG AATAGATGCC GAAACGTAGA GTCTATTGTG AGATCTGTAG TTCAGTCTCA  TGTCCGGTCT ATCCCGGCTA ATGCACCTGG AATTTTGCGA ATGCATTTCC ACGATTGCTT TGTCCATGGC TGCGATGGCT CGGTTCTCCT CGCTGGTAAC ACCTCAGAGA GAACCGCAGT  TCCGAACCGT TCATTGAGAG GGTTCGAAGT TATTGAAGAA GCTAAGGCTC GGCTTGAGAA GGCTTGTCCT CGTACCGTTT CTTGTGCTGA TATTCTCACC CTTGCAGCCC GAGACGCCGT  CGTTTTGACC GGTGGACAAC GCTGGGAAGT GCCCTTGGGA CGTCTCGACG GCCGAATCTC GCAAGCCTCA GACGTGAACT TGCCCGGACC AAGCGACTCC GTTGCTAAGC AGAAGCAAGA  CTTCGCTGCT AAAACTCTCA ACACATTAGA CCTCGTGACT CTTGTTGGCG GACACACAAT AGGAACTGCT GGCTGCGGTC TAGTAAGGGG AAGGTTCGTT AACTTCAACG GCACAGGACA  ACCTGACCCA TCAATCGACC CGAGTTTTGT GCCGCTGATT CTGGCTCAGT GCCCTCAAAA TGGAGGCACC CGAGTGGAGT TAGACGAGGG AAGTGTTGAC AAGTTTGACA CATCGTTCCT  AAGGAAGGTG ACGTCAAGTC GCGTGGTTCT CCAATCCGAT CTAGTCCTAT GGAAGGATCC CGAGACCCGA GCCATCATTG AACGTTTATT AGGATTACGC CGACCATCCT TGAGGTTCGG  AACCGAGTTC GGGAAGTCGA TGGTCAAAAT GAGTCTCATA GAAGTTAAGA CTGGATCAGA TGGGGAGATT CGTCGGGTTT GTTCCGCCAT CAACTAAGAT TTAAAAAAAC ACAAATGTGA  GCTTTGTTTT TCATTTATGA ATTCGTTAAT TAATAATCAC TTGTTTTAAA TAAAAGCTTG CTACAGCATT TTGTGGTCGA TGGTTACGTT TTGATTTTCA AGTGTAAGAT TGTACTTGTA 
AACAAAAAAT GTATTATATA AAAGTGTTAT TTGTTTCTTC 

Retrieve as FASTA