Entry information : AniCcP02 (ccp1)
Entry ID 2359
Creation 2006-08-29 (Nenad Bakalovic)
Last sequence changes 2012-04-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Christophe Dunand)
Peroxidase information: AniCcP02 (ccp1)
Name (synonym) AniCcP02 (ccp1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniCcP02
start..stop
S start..stop
AnCcP02 589 0 12..361 12..364
AcarCcP02 587 0 12..361 12..366
NfCcP02 583 0 15..361 20..366
AorCcP02 582 0 12..361 12..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1416047..1416388 342 N° 2 1416447..1417190 744  
join(1416047..1416388,1416447..1417190)


exon

Literature and cross-references AniCcP02 (ccp1)
Literature Birren,B. et al., Genome Sequence of Aspergillus nidulans, unpublished
Protein ref. UniProtKB:   P0C0V3
DNA ref. JGI genome:   ChrVII_A_nidulans_FGSC_A4 (1416047..1417190)
Protein sequence: AniCcP02 (ccp1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362
PWM (Da):   %s   39911.95  
PI (pH):   %s   9.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAARSASRAFLRSSLRPAVRSSRFALPTQGLRVASRRGYSSEASSGKSSNTLLWAGVALAGGAGAYFYLQGGDVGASTKVFTPTKEDYQKVYNAIAERLANETDYDDGSYGPVLVRLAWHASGTYDAETGTGGSNGATMRFAPESDHGANAGLKYARDFLEPIKAKFPWITYSDLWTLAGACAIQELGGPDIPWRPGRQDKDVSGCTPDGRLPDATKNQDHIRAIFGRMGFDDREMVALIGAHALGRAHTDRSGFDGPWNFSPTVFTNEFFRLLVEEKWQPRKWNGPKQFTDNTTKTLMMFPTDLALVQDKGFRKHVERYAKDSDAFFKEFSEVFVKLLELGVPFNSKVEDRYVFKRSE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo VII, 2 introns). No EST. Strain="FGSC A4".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCTGCTCGATCCGCATCACGCGCCTTCTTGCGCTCTTCCCTCAGACCAGCTGTCCGCAGCTCCCGGTTTGCTCTTCCTACTCAAGGCCTCCGCGTTGCTTCTCGCCGTGGA
TACTCTTCCGAGGCGAGCTCCGGGAAGTCTTCTAACACCCTCCTGTGGGCCGGTGTTGCTCTCGCAGGTGGTGCCGGTGCATACTTCTACCTCCAGGGCGGCGATGTTGGCGCTAGCACC
AAGGTCTTCACTCCTACAAAGGAAGACTACCAGAAGGTGTATAATGCCATTGCCGAGCGTCTCGCCAACGAAACCGACTACGATGATGGCAGCTATGGACCT
GTAAGCTTCTCGGTCTCG
TGCTTGTGTCTGCTCTCCAACTAATGTCCCGACTCTCTAGGTCCTTGTCCGTCTAGCCTGGCACGCAAGCGGCACCTACGACGCAGAAACCGGTACTGGTGGCAGCAACGGCGCGACCAT
GCGTTTCGCCCCCGAGTCTGACCACGGCGCCAACGCCGGTCTCAAGTACGCCCGTGACTTCCTCGAGCCCATCAAGGCCAAATTCCCCTGGATCACCTACTCCGACTTGTGGACACTTGC
GGGAGCCTGCGCGATCCAGGAACTCGGCGGCCCAGACATCCCCTGGCGCCCTGGCCGCCAGGACAAGGACGTTTCTGGCTGCACACCTGACGGCCGTCTTCCTGACGCGACCAAGAACCA
AGACCACATCCGTGCCATTTTCGGACGCATGGGTTTCGATGACCGCGAGATGGTTGCTTTGATCGGTGCACACGCTCTTGGTCGTGCTCACACGGACCGCTCTGGTTTCGATGGACCCTG
GAACTTCAGCCCTACCGTCTTCACAAACGAGTTTTTCCGCCTGTTGGTTGAGGAGAAGTGGCAGCCGCGGAAGTGGAACGGCCCCAAGCAGTTCACTGATAACACAACCAAGACACTGAT
GATGTTCCCGACTGACCTGGCACTTGTCCAGGACAAGGGGTTCAGGAAGCATGTTGAGCGGTATGCTAAGGACAGCGACGCCTTCTTCAAGGAGTTCTCTGAGGTCTTTGTCAAGCTGCT
TGAGCTTGGTGTGCCTTTCAACAGCAAGGTTGAGGACCGATATGTCTTCAAGAGGTCTGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCTGCTCGATCCGCATCACGCGCCTTCTTGCGCTCTTCCCTCAGACCAGCTGTCCGCAGCTCCCGGTTTGCTCTTCCTACTCAAGGCCTCCGCGTTGCTTCTCGCCGTGGA
TACTCTTCCGAGGCGAGCTCCGGGAAGTCTTCTAACACCCTCCTGTGGGCCGGTGTTGCTCTCGCAGGTGGTGCCGGTGCATACTTCTACCTCCAGGGCGGCGATGTTGGCGCTAGCACC
AAGGTCTTCACTCCTACAAAGGAAGACTACCAGAAGGTGTATAATGCCATTGCCGAGCGTCTCGCCAACGAAACCGACTACGATGATGGCAGCTATGGACCT
GTCCTTGTCCGTCTAGCC
TGGCACGCAAGCGGCACCTACGACGCAGAAACCGGTACTGGTGGCAGCAACGGCGCGACCATGCGTTTCGCCCCCGAGTCTGACCACGGCGCCAACGCCGGTCTCAAGTACGCCCGTGAC
TTCCTCGAGCCCATCAAGGCCAAATTCCCCTGGATCACCTACTCCGACTTGTGGACACTTGCGGGAGCCTGCGCGATCCAGGAACTCGGCGGCCCAGACATCCCCTGGCGCCCTGGCCGC
CAGGACAAGGACGTTTCTGGCTGCACACCTGACGGCCGTCTTCCTGACGCGACCAAGAACCAAGACCACATCCGTGCCATTTTCGGACGCATGGGTTTCGATGACCGCGAGATGGTTGCT
TTGATCGGTGCACACGCTCTTGGTCGTGCTCACACGGACCGCTCTGGTTTCGATGGACCCTGGAACTTCAGCCCTACCGTCTTCACAAACGAGTTTTTCCGCCTGTTGGTTGAGGAGAAG
TGGCAGCCGCGGAAGTGGAACGGCCCCAAGCAGTTCACTGATAACACAACCAAGACACTGATGATGTTCCCGACTGACCTGGCACTTGTCCAGGACAAGGGGTTCAGGAAGCATGTTGAG
CGGTATGCTAAGGACAGCGACGCCTTCTTCAAGGAGTTCTCTGAGGTCTTTGTCAAGCTGCTTGAGCTTGGTGTGCCTTTCAACAGCAAGGTTGAGGACCGATATGTCTTCAAGAGGTCT
GAGTAA

Retrieve as FASTA