Entry information : AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Entry ID 238
Creation 2006-02-07 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Name (synonym) AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Mixed tissues
Pericycle cells (roots)
Roots
Seedlings
Siliques
Inducer Cold stress
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx72
start..stop
S start..stop
AlyPrx72 685 0 1..336 1..336
AhalPrx01 683 0 1..336 1..336
BstrPrx50 667 0 1..336 1..336
CrubPrx118 666 0 1..336 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26517096..26517329 234 N° 2 26516807..26516998 192 N° 3 26516567..26516732 166 N° 4 26516063..26516481 419
complement(join(26516063..26516481,26516567..26516732,26516807..26516998,2651709 6..26517329))


exon

Literature and cross-references AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Literature Fernández-Pérez F, Pomar F, Pedreño MA, Novo-Uzal E. Suppression of Arabidopsis peroxidase 72 alters cell wall and phenylpropanoid metabolism.Plant Sci. 2015 Oct;239:192-9
Protein ref. UniProtKB:   Q9FJZ9
DNA ref. Phytozome 11:   Chr5 (26517329..26516063)
mRNA ref. GenBank:   NM_126037
Cluster/Prediction ref. Phytozome Gene 11:   19667215 UniGene:   At.25460
Omic ref. AtProteome:   At5g66390 ATTED-II:   At5g66390 e-FP Browser:   At5g66390 ePlant:   At5g66390 Genevestigator:   At5g66390 TAIR:   At5g66390
Protein sequence: AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (313)
PWM (Da):   %s   37239.82 (34819.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.54 (8.55) Peptide Signal:   %s   cut: 24 range:24-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSLNILIAALSLIAFSPFCLCSKAYGSGGYLFPQFYDQSCPKAQEIVQSIVAKAFEHDPRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKHALEQECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTILTKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDMTLSQYYATLLRQRCPRSGGDQTLFFLDFATPFKFDNHYFKNLIMYKGLLSSDEILFTKNKQSKELVELYAENQEAFFEQFAKSMVKMGNISPLTGAKGEIRRICRRVNHAY

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 6 cDNA and 29 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCCAAATA TTGATTCATT AAACTAATAG TTGATCCATA TCCGAAACCG GACTATAAAA CTATCTTCAA TGCGTTAACG AATCTTCATC GATCAAACTC ATCAAAGTCT AATATCACAA  AGAAAGAGTT TTTTTAACTA GCTTAGCTCA AAGTGTTTGC TTAAGACAAG AAGAACATGG CGTCTTACCA GAACCGTCCA GGAGGTCAGG CCACTGACGA GTACGGAAAC CCGATCCAGC  AGCAGTATGA CGAGTACGGA AATCCGATGG GAGGAGGAGG ATACGGAACT GGTGGTGGTG GAGGAGCTAC AGGTGGCCAA GGATACGGAA CAGGTGGCCA AGGGTACGGA TCAGGTGGCC  AAGGGTACGG AACCGGTGGC CAAGGATACG GAACCGGGAC CGGGACTGAA GGCTTTGGAA CTGGCGGAGG AGCTAGGCAC CACGGCCAAG AGCAACTCCA CAAGGAAAGT GGTGGTGGCT  TGGGAGGAAT GCTTCACCGC TCCGGATCTG GATCCAGCTC TAGCTCGGTA CGTATCAAGT GTATAAAGAA GATTTATGAT GTTTTAGTTT AGTATGTGAA GCGTAATTCG AATGTTATAT  GTATAACAGG AGGATGATGG ACAAGGAGGG AGGAGGAAGA AGGGAATAAC ACAAAAGATC AAGGAGAAGT TGCCAGGTCA TCATGATCAG TCTGGTCAAG CTCAAGCGAT GGGCGGCATG  GGATCCGGAT ATGATGCTGG TGGCTACGGT GGTGAGCACC ACGAGAAGAA GGGGATGATG GACAAGATCA AGGAAAAGCT TCCCGGTGGT GGCCGTTAAG CTTCGAACAA TCGTGTATAC  ATATTAAATA AAAATAATGA GGGTTTGTAA CGCAGTCGCA TTCGGTCGTT GTATTGTGCT TTTTATGTAT GTACGTCCTG CGATGTGTGT TGTTTACTTA CATGAGTGTG TAATGAGCAT  CTGGCTCTTT TTATGTTCTG AGATGTTTGT GTTATGTAAT TTCACATCTA TATAAATCTA CTTTCTTCTG CTTAGTTTGT GTTACACCTC TCGTCCACTG TGAACTCCGT TAACGCACTA  CAATTAGTGT AGTAGAGTGT AGACGTACAT GTTAAGATGG GATTAGGCCT GTTTTCGAAC TCGTATTCCC CATTTTGCTG GGTTTAACCT TGGGCCGAAT CATAATTTGA TGCTTGGGCC  TATGAAATGG AGAGATTTTA TTAGTGATCT GTATTTTCTG AACGTAGGTA AAAGACGTGA GAAAATGATC AAAAGACATT GAAAAAGTCT CAATACATCG TCCGGTGATA TTTCTTTAAA  ATGACGACTT CTTCTTCTTT GCCATTACTG CACGAAAAGA AAAGGACATA GTTGGTTTGG TTTTGTGAAG GAGAGCAGTT GAAGCTGTTT CTCAATGATT TTGTCATTAT CTAGCGTTTA  TTATGTCTTT GGCGTACTCT ATCAACCGTA TCTATTTGTT AAGCACACAA TGTTAATTAG TTTGCTTGCA GAATAATTAG CATTTTTTTT TGACTATTTG TTCAACGGTC AACCAAGTAA  AACCCTATGG ATGTAATTGT TTTGCGTAGC TTAATCATCT TCAGGCTGAT CTCTCAATTT AATAAAACAT AAATCCCCAT AGAAATCTTC TCCGCGTTGA CTATTAAAAG CAAAATTGTG  CTTTAAGTGT TGCTAATGCA TGGAACAAAA ATCCCACACA ACAACTGCGA ATAATCTATT GATATGAGGT GCATAAAGTG ATCATACATG AGAAATATAC GAAAAGAATT CTAACAAATC  TTGTATTCAT ACCAATTCAA ATATCAATGT ATCCATCTAA TCCAATATAT AGCTAAAATT AGATACCAAC TCCAACGTCT TTCTCAATTG TCCACAAAGT CTACTCTATA AATGCAACCC 
TTGGCATCAC ACACAATCAC CAAGTACAAG TAACCGAGTT ATATACAACG AGTCATCAAG AGAAAGAATC CCCCCAAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACAAATCCA TCTTTATAAT TTATGTACAA TATAATGCTT TCGTTTCTCA TTGAGTTTTC AATTTCTTTT GGCTTTGTTT GCATGAGTGT GTATCATATG TTTATTACTC AAATCTGATT  TTGTTTCGGA AAAAGATTAT CTATATACTA TTTGCTTTAT TTCCAGCGTT GAACTTGCAA TGGTACAACC AACATTAACC TAAACGTTTT AAATAGTAAG CCTCATATAT TGTTCAGAAT  GAACTAAAAG TGTTGGGCTT TGGGTTTTTA GAATTAACTA AACGTATTGG GCCTCAAATA ACTATCGAAA CCTCTTCTGA TTTGGGTTTT AGCTTCCGAG TAAAACGGCG CCGTGTTGGA  AGCATATCTT GAACGGACGG CAGAACTCGG AGTCGGAGAT CGTACCGGAG GACGGCGAAT CTTCCATCTA CTGTCCTTTC GTTTTTTATA CGCGTCAAAT GAGTCTTTAA CTTCAGATTA  GCTCTGTAAA CAATCGCGAT TAGTCCGGAT TGCATCTAAG GATTCGTTGA TGGCGGCGTC GTGGCAGTGG GAAAATGCCA CCGCCGGCGC CGTCGCTGGA TTCGCCACCG TAGCTGCTAT  GCACTCTCTT GATGTTGTTC GTACGAGATT CCAAGGTCTG GTTTTTCACT CCTGGATTAA CTCATCGATT TTGCTTTTAA AAAGTTGCTA ACTTGATTGA ACAACAGTCA ACGACGGAAG  AGGGTCAAGT CTGCCGACGT ACAAGAACAC TGCTCACGCT GTCTTCACCA TTGCCCGTCT CGAGGTTTCC CAGATGAAAC TCTCTTCTGG CATCTTCCAT ATTATCTTCT CTATGTTATG  TGGTTGACTC ATTTGGTTTA AATCTTCTGT AGGGTTTGAG AGGGCTTTAT GCAGGCTTCT TCCCTGCAGT TATCGGTTCT ACTGTTTCCT GGGGCTTATA CTTCTTTTTG TGAGTGTTAC 
TTTCGTTTAG CACATATCTT CTTTCTTCAT GATTTCTATT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTCATTGAACATCCTTATTGCAGCTCTCTCGCTCATTGCATTTTCTCCTTTTTGTTTGTGTTCCAAAGCCTATGGAAGTGGCGGCTATCTCTTTCCTCAGTTTTATGACCAA
TCGTGTCCTAAAGCTCAAGAGATTGTTCAGTCCATTGTCGCTAAAGCATTCGAACATGATCCTCGCATGCCTGCCTCCTTGCTCAGACTCCATTTCCACGACTGTTTCGTCAAG
GTCTCA
AGCTTAGCAAAATTTCGTAACGTTTAAAAACATACGGAAATTTTCCAATCTTAATATATTTTTATCCTTGTGATATATATTTGTGCTGCAGGGATGTGATGCTTCCATACTATTGGACAG
CAGTGGAACCATAATCAGCGAGAAACGATCAAACCCTAACAGAAACTCAGCCCGTGGTTTCGAACTCATCGAGGAAATCAAACATGCCTTAGAACAAGAGTGTCCTGAAACAGTTTCTTG
CGCTGATATCTTGGCTCTAGCCGCTAGAGACTCAACTGTTATT
GTAAGTACTCATCACAATTCACTACACACAAAATTAGTTGATTATTATCAATAATTTGACAAATGAAATAACAGACG
GGTGGACCGAGCTGGGAAGTACCTCTAGGAAGAAGAGACGCGAGAGGAGCAAGCTTGAGTGGTTCCAACAACGACATTCCTGCTCCAAACAACACTTTCCAAACCATCCTCACTAAGTTC
AAGCGTCAAGGCCTTGATCTCGTCGATCTTGTCTCCCTCTCAG
GTATACATATCTATCCATCTTTATTACACGAAACATTTTCAATAACTTATTACACTTTTAAGAAGCGGATACATATG
ATTTATAGGAAGTCACACCATTGGAAACTCGAGGTGCACAAGTTTCCGACAGAGGTTATACAATCAATCCGGCAACGGAAAGCCTGATATGACTCTTAGCCAATACTATGCAACACTATT
GCGTCAACGATGTCCGAGATCCGGAGGTGACCAGACCCTATTCTTCCTCGACTTCGCGACACCGTTCAAGTTTGACAACCACTACTTCAAGAACCTGATAATGTACAAAGGTCTATTGAG
CTCTGATGAGATTCTGTTCACGAAGAACAAACAGTCCAAGGAGCTGGTGGAGCTATACGCTGAGAATCAAGAGGCCTTCTTTGAGCAGTTTGCTAAATCGATGGTGAAGATGGGAAATAT
CTCTCCGTTGACAGGCGCCAAGGGAGAGATCAGGCGTATCTGTCGGAGGGTTAACCATGCTTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTCATTGAACATCCTTATTGCAGCTCTCTCGCTCATTGCATTTTCTCCTTTTTGTTTGTGTTCCAAAGCCTATGGAAGTGGCGGCTATCTCTTTCCTCAGTTTTATGACCAA
TCGTGTCCTAAAGCTCAAGAGATTGTTCAGTCCATTGTCGCTAAAGCATTCGAACATGATCCTCGCATGCCTGCCTCCTTGCTCAGACTCCATTTCCACGACTGTTTCGTCAAG
GGATGT
GATGCTTCCATACTATTGGACAGCAGTGGAACCATAATCAGCGAGAAACGATCAAACCCTAACAGAAACTCAGCCCGTGGTTTCGAACTCATCGAGGAAATCAAACATGCCTTAGAACAA
GAGTGTCCTGAAACAGTTTCTTGCGCTGATATCTTGGCTCTAGCCGCTAGAGACTCAACTGTTATT
ACGGGTGGACCGAGCTGGGAAGTACCTCTAGGAAGAAGAGACGCGAGAGGAGCA
AGCTTGAGTGGTTCCAACAACGACATTCCTGCTCCAAACAACACTTTCCAAACCATCCTCACTAAGTTCAAGCGTCAAGGCCTTGATCTCGTCGATCTTGTCTCCCTCTCAG
GAAGTCAC
ACCATTGGAAACTCGAGGTGCACAAGTTTCCGACAGAGGTTATACAATCAATCCGGCAACGGAAAGCCTGATATGACTCTTAGCCAATACTATGCAACACTATTGCGTCAACGATGTCCG
AGATCCGGAGGTGACCAGACCCTATTCTTCCTCGACTTCGCGACACCGTTCAAGTTTGACAACCACTACTTCAAGAACCTGATAATGTACAAAGGTCTATTGAGCTCTGATGAGATTCTG
TTCACGAAGAACAAACAGTCCAAGGAGCTGGTGGAGCTATACGCTGAGAATCAAGAGGCCTTCTTTGAGCAGTTTGCTAAATCGATGGTGAAGATGGGAAATATCTCTCCGTTGACAGGC
GCCAAGGGAGAGATCAGGCGTATCTGTCGGAGGGTTAACCATGCTTATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACCAAGTACA AGTAACCGAG TTATATACAA CGAGTCATCA AGAGAAAGAA TCCCCCCAAA AAATGGCCAA GTCATTGAAC ATCCTTATTG CAGCTCTCTC GCTCATTGCA TTTTCTCCTT  TTTGTTTGTG TTCCAAAGCC TATGGAAGTG GCGGCTATCT CTTTCCTCAG TTTTATGACC AATCGTGTCC TAAAGCTCAA GAGATTGTTC AGTCCATTGT CGCTAAAGCA TTCGAACATG  ATCCTCGCAT GCCTGCCTCC TTGCTCAGAC TCCATTTCCA CGACTGTTTC GTCAAGGGAT GTGATGCTTC CATACTATTG GACAGCAGTG GAACCATAAT CAGCGAGAAA CGATCAAACC  CTAACAGAAA CTCAGCCCGT GGTTTCGAAC TCATCGAGGA AATCAAACAT GCCTTAGAAC AAGAGTGTCC TGAAACAGTT TCTTGCGCTG ATATCTTGGC TCTAGCCGCT AGAGACTCAA  CTGTTATTAC GGGTGGACCG AGCTGGGAAG TACCTCTAGG AAGAAGAGAC GCGAGAGGAG CAAGCTTGAG TGGTTCCAAC AACGACATTC CTGCTCCAAA CAACACTTTC CAAACCATCC  TCACTAAGTT CAAGCGTCAA GGCCTTGATC TCGTCGATCT TGTCTCCCTC TCAGGAAGTC ACACCATTGG AAACTCGAGG TGCACAAGTT TCCGACAGAG GTTATACAAT CAATCCGGCA  ACGGAAAGCC TGATATGACT CTTAGCCAAT ACTATGCAAC ACTATTGCGT CAACGATGTC CGAGATCCGG AGGTGACCAG ACCCTATTCT TCCTCGACTT CGCGACACCG TTCAAGTTTG  ACAACCACTA CTTCAAGAAC CTGATAATGT ACAAAGGTCT ATTGAGCTCT GATGAGATTC TGTTCACGAA GAACAAACAG TCCAAGGAGC TGGTGGAGCT ATACGCTGAG AATCAAGAGG  CCTTCTTTGA GCAGTTTGCT AAATCGATGG TGAAGATGGG AAATATCTCT CCGTTGACAG GCGCCAAGGG AGAGATCAGG CGTATCTGTC GGAGGGTTAA CCATGCTTAT TAATACAAAT  CCATCTTTAT AATTTATGTA CAATATAATG CTTTCGTTTC TCATTGAGTT TTCAATTTCT TTTGGCTTTG TTTGCATGAG TGTGTATCAT ATGTTTATTA CTCAAATCTG ATTTTGTTTC 
GGAAAAAGAT TATCTATATA 

Retrieve as FASTA