Entry information : PcMnP02_RP78 (MP-1)
Entry ID 2383
Creation 2007-12-26 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-23 (Christophe Dunand)
Peroxidase information: PcMnP02_RP78 (MP-1)
Name (synonym) PcMnP02_RP78 (MP-1)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcMnP02_RP78
start..stop
S start..stop
PcMnP02_OGC101 772 0 1..382 1..382
PcMnP05 692 0 1..382 1..381
PsoMnP02 669 0 1..382 1..377
PbreMnP04 646 0 1..382 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 506005..506133 129 N° 2 506187..506238 52 N° 3 506295..506321 27 N° 4 506372..506411 40
N° 5 506468..506645 178 N° 6 506699..506920 222 N° 7 506971..507388 418 N° 8 507444..507526 83
join(506005..506133,506187..506238,506295..506321,506372..506411,506468..506645, 506699..506920,506971..507388,507444..507526)


exon

Literature and cross-references PcMnP02_RP78 (MP-1)
Literature Pease E.A., Andrawis A., Tien M. Manganese-dependent peroxidase from Phanerochaete chrysosporium. Primary structure deduced from cDNA sequence. J. Biol. Chem. 264:13531-13535(1989).
Protein ref. UniProtKB:   P19136   A7U4R1 [Fragment]
DNA ref. JGI genome:   scaffold_5 (506005..507526)
mRNA ref. GenBank:   J04980
Protein sequence: PcMnP02_RP78 (MP-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (364)
PWM (Da):   %s   40018.64 (38214.6)  
PI (pH):   %s   4.32 (4.28) Peptide Signal:   %s   cut: 19 range:19-382
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFGSLLAFVALAAITRAAPTAESAVCPDGTRVTNAACCAFIPLAQDLQETLFQGDCGEDAHEVIRLTFHDAIAISQSLGPQAGGGADGSMLHFPTIEPNFSANSGIDDSVNNLLPFMQKHDTISAADLVQFAGAVALSNCGAPRLEFMAGRPNTTIPAVEGLIPEPQDSVTKILQRFEDAGNFSPFEVVSLLASHTVARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGTGFPGSNNNTGEVMSPLPLGSGSDTGEMRLQSDFALARDERTACFWQSFVNEQEFMAASFKAAMAKLAILGHSRSSLIDCSDVVPVPKPAVNKPATFPATKGPKDLDTLTCKALKFPTLTSDPGATETLIPHCSNGGMSCPGVQFDGPA

Retrieve as FASTA  
Remarks Complete sequence from mRNA. Strain="ATCC 24725 / CBS 481.73 / CCRC 36200 / NRRL 6361 / VKM-F-1767", "RP78" and "FPL5157". Peroxidase manganese-dependent H4 [Precursor]
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGGTTCTCTCCTCGCCTTCGTGGCTCTCGCCGCCATAACTCGCGCCGCCCCGACTGCGGAGTCTGCAGTCTGTCCAGACGGTACCCGCGTCACCAACGCGGCGTGCTGCGCT
TTCATTCCG
GTAAATCCTGATTATTTCTATGCTCAAATCGCAATCCTGATTCCTCCCCTTAGCTCGCACAGGATTTGCAAGAGACTCTGTTCCAGGGTGACTGTGGCGAAGATGGTATTT
CATCCTTCTAGTGGCGCCGCCCACATCCTAGCTAACGTGTTGTGCTTCAGCCCACGAAGTCATCCGTCTGACCTTCCGTGAGTAAATTGATAGATAATCCTCAAGGTTGTACTGACGGAG
GCCTTAGACGACGCTATTGCAATCTCCCAGAGCCTAGGTCCTCAGGCGTGAGTTTCACTTTTGTGCACCCTCTAGAACCAGTAAACTCACTATGTCATAATAGTGGCGGCGGTGCTGACG
GCTCCATGCTGCACTTCCCGACAATCGAGCCCAACTTCTCCGCCAACAGCGGCATCGATGACTCCGTCAACAACTTGCTTCCCTTCATGCAGAAACACGACACCATCAGTGCCGCCGATC
TTGTACAGTTCGCCGGTGCGGTCGCGCTGAGCAACTGCCCA
GTAAGCCGCATACCAGTCTAGATTGGCTCGCACAGCGTCTGACATGCGATCAGGGTGCTCCTCGCCTCGAGTTCATGGC
TGGACGTCCGAACACTACCATCCCCGCAGTTGAGGGCCTCATTCCTGAGCCTCAAGACAGCGTCACCAAAATCCTGCAGCGCTTCGAGGACGCCGGCAACTTCTCGCCGTTCGAGGTCGT
CTCGCTCCTGGCTTCACACACCGTTGCTCGTGCGGACAAGGTCGACGAGACCATCGATGCTGCGCCCTTCGACTCG
GTAAGACTTCTTTGCCTTTGCCTCAGTGTCGCGCTAACAACCAT
CGCCAGACACCCTTCACCTTCGACACCCAGGTGTTCCTCGAGGTCCTGCTCAAGGGCACAGGCTTCCCGGGCTCGAACAACAACACCGGCGAGGTGATGTCGCCGCTCCCACTCGGCAGC
GGCAGCGACACGGGCGAGATGCGCCTGCAGTCCGACTTTGCGCTCGCGCGCGACGAGCGCACGGCGTGCTTCTGGCAGTCGTTCGTCAACGAGCAGGAGTTCATGGCGGCGAGCTTCAAG
GCCGCGATGGCGAAGCTTGCGATCCTCGGCCACAGCCGCAGCAGCCTCATTGACTGCAGCGACGTCGTCCCCGTCCCGAAGCCCGCCGTCAACAAGCCCGCGACGTTCCCCGCGACGAAG
GGCCCCAAGGACCTCGACACGCTCACGTGCAAGGCCCTCAAGTTCCCGACGCTGACCTCTGACC
GTGAGTGACTTATTCGTTCACGAATAAGAATGAACCCTGACCCAAGATTCTCTAGC
CGGTGCTACCGAGACCCTCATCCCCCACTGCTCCAACGGCGGCATGTCCTGCCCTGGTGTTCAGTTCGATGGCCCTGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGGTTCTCTCCTCGCCTTCGTGGCTCTCGCCGCCATAACTCGCGCCGCCCCGACTGCGGAGTCTGCAGTCTGTCCAGACGGTACCCGCGTCACCAACGCGGCGTGCTGCGCT
TTCATTCCG
CTCGCACAGGATTTGCAAGAGACTCTGTTCCAGGGTGACTGTGGCGAAGATGCCCACGAAGTCATCCGTCTGACCTTCCACGACGCTATTGCAATCTCCCAGAGCCTAGGT
CCTCAGGC
TGGCGGCGGTGCTGACGGCTCCATGCTGCACTTCCCGACAATCGAGCCCAACTTCTCCGCCAACAGCGGCATCGATGACTCCGTCAACAACTTGCTTCCCTTCATGCAGAAA
CACGACACCATCAGTGCCGCCGATCTTGTACAGTTCGCCGGTGCGGTCGCGCTGAGCAACTGCCCA
GGTGCTCCTCGCCTCGAGTTCATGGCTGGACGTCCGAACACTACCATCCCCGCA
GTTGAGGGCCTCATTCCTGAGCCTCAAGACAGCGTCACCAAAATCCTGCAGCGCTTCGAGGACGCCGGCAACTTCTCGCCGTTCGAGGTCGTCTCGCTCCTGGCTTCACACACCGTTGCT
CGTGCGGACAAGGTCGACGAGACCATCGATGCTGCGCCCTTCGACTCG
ACACCCTTCACCTTCGACACCCAGGTGTTCCTCGAGGTCCTGCTCAAGGGCACAGGCTTCCCGGGCTCGAAC
AACAACACCGGCGAGGTGATGTCGCCGCTCCCACTCGGCAGCGGCAGCGACACGGGCGAGATGCGCCTGCAGTCCGACTTTGCGCTCGCGCGCGACGAGCGCACGGCGTGCTTCTGGCAG
TCGTTCGTCAACGAGCAGGAGTTCATGGCGGCGAGCTTCAAGGCCGCGATGGCGAAGCTTGCGATCCTCGGCCACAGCCGCAGCAGCCTCATTGACTGCAGCGACGTCGTCCCCGTCCCG
AAGCCCGCCGTCAACAAGCCCGCGACGTTCCCCGCGACGAAGGGCCCCAAGGACCTCGACACGCTCACGTGCAAGGCCCTCAAGTTCCCGACGCTGACCTCTGACC
CCGGTGCTACCGAG
ACCCTCATCCCCCACTGCTCCAACGGCGGCATGTCCTGCCCTGGTGTTCAGTTCGATGGCCCTGCCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGCTCTCA AGGACATCCG CACTCGAATA TCGCAATGGC CTTCGGTTCT CTCCTCGCCT TCGTGGCTCT CGCCGCCATA ACTCGCGCCG CCCCGACTGC GGAGTCTGCA GTCTGTCCAG  ACGGTACCCG CGTCACCAAC GCGGCGTGCT GCGCTTTCAT TCCGCTCGCA CAGGATTTGC AAGAGACTCT GTTCCAGGGT GACTGTGGCG AAGATGCCCA CGAAGTCATC CGTCTGACCT  TCCACGACGC TATTGCAATC TCCCAGAGCC TAGGTCCTCA GGCTGGCGGC GGTGCTGACG GCTCCATGCT GCACTTCCCG ACAATCGAGC CCAACTTCTC CGCCAACAGC GGCATCGATG  ACTCCGTCAA CAACTTGCTT CCCTTCATGC AGAAACACGA CACCATCAGT GCCGCCGATC TTGTACAGTT CGCCGGTGCG GTCGCGCTGA GCAACTGCCC AGGTGCTCCT CGCCTCGAGT  TCATGGCTGG ACGTCCGAAC ACTACCATCC CCGCAGTTGA GGGCCTCATT CCTGAGCCTC AAGACAGCGT CACCAAAATC CTGCAGCGCT TCGAGGACGC CGGCAACTTC TCGCCGTTCG  AGGTCGTCTC GCTCCTGGCT TCACACACCG TTGCTCGTGC GGACAAGGTC GACGAGACCA TCGATGCTGC GCCCTTCGAC TCGACACCCT TCACCTTCGA CACCCAGGTG TTCCTCGAGG  TCCTGCTCAA GGGCACAGGC TTCCCGGGCT CGAACAACAA CACCGGCGAG GTGATGTCGC CGCTCCCACT CGGCAGCGGC AGCGACACGG GCGAGATGCG CCTGCAGTCC GACTTTGCGC  TCGCGCGCGA CGAGCGCACG GCGTGCTTCT GGCAGTCGTT CGTCAACGAG CAGGAGTTCA TGGCGGCGAG CTTCAAGGCC GCGATGGCGA AGCTTGCGAT CCTCGGCCAC AGCCGCAGCA  GCCTCATTGA CTGCAGCGAC GTCGTCCCCG TCCCGAAGCC CGCCGTCAAC AAGCCCGCGA CGTTCCCCGC GACGAAGGGC CCCAAGGACC TCGACACGCT CACGTGCAAG GCCCTCAAGT  TCCCGACGCT GACCTCTGAC CCCGGTGCTA CCGAGACCCT CATCCCCCAC TGCTCCAACG GCGGCATGTC CTGCCCTGGT GTTCAGTTCG ATGGCCCTGC CTAAACCACT CACCTCCGGC 
AATGCACCTT TAGTAGATGT CGATTCTATT TGGTTGATTA GAAGTACTGG GTTCTCGTGT CATATACCAC CAAGTTTTCA GAATGCAAGT CTCCTTTCTT TCCAAAAAAA AAA 

Retrieve as FASTA