Entry information : BspCIIBB (RBPa)
Entry ID 2395
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2011-10-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Christophe Dunand)
Peroxidase information: BspCIIBB (RBPa)
Name (synonym) BspCIIBB (RBPa)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera sp. B33/3    [TaxId: 183582 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BspCIIBB
start..stop
S start..stop
BaCIIBB07 685 0 1..367 1..366
BaCIIBB07_UAMH8258 683 0 1..367 1..366
BspCIIBB_other 681 0 30..367 1..338
BaCIIBB08 587 0 1..367 1..366
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..64 64 N° 2 124..274 151 N° 3 327..383 57 N° 4 439..573 135
N° 5 629..708 80 N° 6 758..799 42 N° 7 854..932 79 N° 8 991..1116 126
N° 9 1175..1290 116 N° 10 1342..1517 176 N° 11 1570..1634 65 N° 12 1689..1701 13
join(1..64,124..274,327..383,439..573,629..708,758..799,854..932,991..1116,1175. .1290,1342..1517,1570..1634,1689..1701)


exon

Literature and cross-references BspCIIBB (RBPa)
Literature Moreira P.R., Duez C., Dehareng D., Antunes A., Almeida-Vara E., Frere J.M., Malcata F.X., Duarte J.C. Molecular characterisation of a versatile peroxidase from a Bjerkandera strain. J. Biotechnol. 118:339-352(2005).
Protein ref. UniProtKB:   Q874A6
DNA ref. GenBank:   AY217015.1
Protein sequence: BspCIIBB (RBPa)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (345)
PWM (Da):   %s   38440.93 (36154.7)  
PI (pH):   %s   4.19 (4.15) Peptide Signal:   %s   cut: 23 range:23-367
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLLTAALSIALALPFSQAAITRRVACPDGVNTATNAACCALFAVRDDIQQNLFDGGECGEEVHESLRLTFHDAIGISPSLAATGKFGGGGADGSIMIFDDIEPNFHANNGVDEIINAQKPFVAKHNMTAGDFIQFAGAVGVSNCPGAPQLSFFLGRPATQPAPDGLVPEPFDSVTDILNRFADAGGFTIQEVVWLLASHSIAAADHVDPTIPGSPFDSTPEIFDTQFFVETLLKGTLFPGTSGNQGEVESPLAGEIRLQSDADFARDSRTACEWQSFNNQPRMQVLFKAAMQKLSILGHDLTQMIDCSDVIPVPPSTAVRGSHLPAGNTLDDIEQCASTPFPSLTADPGPATSVAPVPPS

Retrieve as FASTA  
Remarks complete sequence from genomic DNA and partial mRNA. Strain="B33/3".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCCTCACTGCTGCTCTTTCCATCGCCCTTGCTCTCCCCTTCTCGCAAGGTTCGTATCTGTTGCTGCAGACCGTATTCTCCTCGATGCTCACCTTTTCCCATCCA
TAGCTGCGATCACCAGACGTGTGGCTTGCCCAGATGGCGTGAACACCGCAACCAACGCAGCCTGTTGTGCTTTGTTCGCCGTCCGTGATGACATCCAACAGAACTTGTTCGACGGCGGCG
AGTGCGGCGAAGAAGTGCACGAGTCACTTCGACT
GTATGGATTTTGTACCCTCGTTGTGAATTCTGCGCTCATTCTCTACCCTTAGGACCTTCCACGATGCTATTGGCATATCTCCAAGC
CTTGCCGCCACTGGCAAATTCGG
GTACATATTGGGACTTTATTTGTATAATCGTGGCGACTAACGACCTGTTACTTAGCGGCGGAGGTGCCGACGGGTCTATCATGATCTTCGACGACAT
CGAGCCCAACTTCCACGCCAACAACGGCGTGGACGAGATTATCAACGCGCAGAAGCCCTTCGTGGCCAAGCACAACATGACGGCAGGTGACTT
GTAAGTTGCTGTTTACTCCCTTAGTGA
TATTACGTTCGCTAAATCACACAAACAGTATTCAATTCGCAGGCGCCGTTGGCGTGAGCAACTGCCCTGGTGCTCCTCAACTGAGCTTCTTCCTCGGGCGCCCTGCAGGTACGGAATTTG
CAACGATTGGATGTTCTTACTCTCACCCTGCTTGTAGCGACGCAGCCCGCGCCTGACGGGCTTGTTCCGGAGCCCTTCGGTCAGTCCAATTATTGTCCCGAATCCTTGCACTCGGACTGA
TGATGTTCATCAGACTCGGTCACCGACATCCTCAATCGCTTTGCCGATGCTGGCGGCTTCACAATTCAAGAAGTTGTTTGGCTCCTTGCCTCGTAAGTACTACCCTGGGCTCGCTAAGTT
TCGGGTCCTAATTGATGATCATGTCCATAGTCATTCCATTGCTGCTGCTGACCACGTCGACCCGACGATCCCTGGATCACCCTTCGATTCTACTCCCGAAATCTTCGACACACAGTTCTT
TGTTGAGACGTTGTTGAAGGGCACGTTGTTCCCAGG
GTAAACCTCGTAACCATACTTTTAATCATGGAAGATGCTAATTTTAATTATGATCTAGTACGAGCGGCAACCAGGGCGAAGTCG
AGTCCCCACTTGCCGGCGAAATTCGTCTCCAGTCAGATGCCGACTTCGCACGTGACTCGAGGACTGCTTGCGAGTGGCAGTCTTTCGTCA
GTGAGTACTTTCTATACAAAAGAAAAACAG
GCATTTATACGATCGCCTCAGATAACCAGCCCCGGATGCAAGTTCTGTTCAAGGCGGCTATGCAGAAGCTGTCTATCTTGGGCCACGATCTCACTCAGATGATTGACTGCTCCGACGTAA
TCCCTGTACCTCCGAGCACAGCGGTCCGTGGATCGCATCTGCCTGCGGGCAACACACTGGATGACATTGAACAGGCT
GTGAGTACTATTTCCCAAATTCTCATAGGTGACAGCCTAACGT
AAGATATAGTGCGCCTCCACGCCATTCCCCTCGCTCACCGCCGACCCTGGTCCGGCCACCTCTGTTGCCCCTGTGTAAGTCTCAACAATACGATATGGTTGAGCGCCCCCATCTGACACT
ACTGATAGCCCGCCTTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCCTCACTGCTGCTCTTTCCATCGCCCTTGCTCTCCCCTTCTCGCAAGCTGCGATCACCAGACGTGTGGCTTGCCCAGATGGCGTGAACACCGCAACCAACGCA
GCCTGTTGTGCTTTGTTCGCCGTCCGTGATGACATCCAACAGAACTTGTTCGACGGCGGCGAGTGCGGCGAAGAAGTGCACGAGTCACTTCGACT
GACCTTCCACGATGCTATTGGCATA
TCTCCAAGCCTTGCCGCCACTGGCAAATTCGG
CGGCGGAGGTGCCGACGGGTCTATCATGATCTTCGACGACATCGAGCCCAACTTCCACGCCAACAACGGCGTGGACGAGATTATCAAC
GCGCAGAAGCCCTTCGTGGCCAAGCACAACATGACGGCAGGTGACTT
TATTCAATTCGCAGGCGCCGTTGGCGTGAGCAACTGCCCTGGTGCTCCTCAACTGAGCTTCTTCCTCGGGCGC
CCTGCAG
CGACGCAGCCCGCGCCTGACGGGCTTGTTCCGGAGCCCTTCGACTCGGTCACCGACATCCTCAATCGCTTTGCCGATGCTGGCGGCTTCACAATTCAAGAAGTTGTTTGGCTC
CTTGCCTC
TCATTCCATTGCTGCTGCTGACCACGTCGACCCGACGATCCCTGGATCACCCTTCGATTCTACTCCCGAAATCTTCGACACACAGTTCTTTGTTGAGACGTTGTTGAAGGGC
ACGTTGTTCCCAGG
TACGAGCGGCAACCAGGGCGAAGTCGAGTCCCCACTTGCCGGCGAAATTCGTCTCCAGTCAGATGCCGACTTCGCACGTGACTCGAGGACTGCTTGCGAGTGGCAG
TCTTTCGTCA
ATAACCAGCCCCGGATGCAAGTTCTGTTCAAGGCGGCTATGCAGAAGCTGTCTATCTTGGGCCACGATCTCACTCAGATGATTGACTGCTCCGACGTAATCCCTGTACCT
CCGAGCACAGCGGTCCGTGGATCGCATCTGCCTGCGGGCAACACACTGGATGACATTGAACAGGCT
TGCGCCTCCACGCCATTCCCCTCGCTCACCGCCGACCCTGGTCCGGCCACCTCT
GTTGCCCCTGT
CCCGCCTTCGTAA

Retrieve as FASTA