Entry information : CcinCIIBA
Entry ID 2403
Creation 2007-02-07 (Christophe Dunand)
Last sequence changes 2013-01-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-03-26 (Christophe Dunand)
Peroxidase information: CcinCIIBA
Name CcinCIIBA
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinCIIBA
start..stop
S start..stop
ArCIIBA 659 0 1..363 1..364
CdCIIBA01 394 3e-137 30..359 28..355
ParcCIIBA04 375 4e-130 23..361 21..360
DsCIIBA06 368 4e-127 5..363 2..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..123 123 N° 2 196..240 45 N° 3 312..330 19 N° 4 409..425 17
N° 5 486..494 9 N° 6 558..616 59 N° 7 685..698 14 N° 8 764..804 41
N° 9 873..951 79 N° 10 1020..1260 241 N° 11 1313..1364 52 N° 12 1421..1565 145
N° 13 1628..1800 173 N° 14 1854..1975 122  
join(1..123,196..240,312..330,409..425,486..494,558..616,685..698,764..804,873.. 951,1020..1260,1313..1364,1421..1565,1628..1800,1854..1975)


exon

Literature and cross-references CcinCIIBA
Literature REFERENCE 1 Baunsgaard,L., Dalboge,H., Houen,G., Rasmussen,E.M. and Welinder,K.G. Amino acid sequence of Coprinus macrorhizus peroxidase and cDNA sequence encoding Coprinus cinereus peroxidase. A new family of fungal peroxidases Eur. J. Biochem. 213 (1), 605-611 (1993).

REFERENCE 2 Baunsgaard,L., Vind,J. and Dalboge,H. Unpublished
Protein ref. UniProtKB:   A8NK72   P28314 [Other strain]
DNA ref. JGI genome:   Chr_10 (1662393..1664366)
mRNA ref. GenBank:   X69457 JGI transcript:   20812
Protein sequence: CcinCIIBA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (345)
PWM (Da):   %s   37545.58 (35745.5)  
PI (pH):   %s   4.37 (4.31) Peptide Signal:   %s   cut: 19 range:19-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSLLSTFAAVIIGALALPQGPGGGGSVTCPGGQSTSNSQCCVWFDVLDDLQTNFYQGSKCESPVRKILRIVFHDAIGFSPALTAAGQFGGGGADGSIIAHSNIELAFPANGGLTDTIEALRAVGINHGVSFGDLIQFATAVGMSNCPGSPRLEFLTGRSNSSQPSPPSLIPGPGNIVTAILDRMGDAGFSPDEVVDLLAAHSLASQEGLNSAIFRSPLDSTPQVFDTQFYIETLLKGTTQPGPSLGFAEELSPFPGEFRMRSDALLARDSRTACRWQSMTSSNEVMGQRYRAAMAKMSVLGFDRNALTDCSDVIPSAVSNNAAPVIPGGLTVDDIEVSCPSEPFPEIATASGPLPSLAPAP

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 10, 14 introns). No EST. Strain="Okayama-7 / 130 / FGSC 9003" and "IFO 8371"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGCTTTTGTCCACCTTCGCTGCTGTCATCATCGGTGCCCTCGCTCTCCCCCAGGGTCCTGGAGGAGGCGGGTCAGTCACTTGCCCCGGTGGACAGTCCACTTCGAACAGC
CAG
GTAAGCCCCTCGACCGTCCTCTGGATCAGCCGACTCGGACAGGAGCTCTAATACCAATCTTCTATCTCCACAGTGCTGCGTCTGGTTCGACGTTCTAGACGATCTTCAGACCAACTT
GTATGTTCCTTCTCTCCGAACAATCCTTTTCCGCATTCTCACCGACGCGACTGTCACCTTTCTAATTATAGCTACCAAGGGTCCAAGTGTGGTAAGGACATTCGCTCCACGCGTTTGACT
GATCTCGGATGTCTTTACTGATCATCTCCTTCGTTCTCAAACGTGCAGAGAGCCCTGTTCGCAAGGTACGTGGAGCATCATTCCTATTTTACACCGTTCCGATATCCTAACCCGCGAATT
TGTAGATTCTTAGAGTGGGTCTTTCGAGTTCTATGTTCTATCATTAGTTCGCTTTTCTGATGACGGGTGTTCTAAAGATTGTTTTCCATGACGCGATCGGATTTTCGCCGGCGTTGACTG
CTGCTGGTCAATTCGG
GTGCGTATACTTCGCGTCTGTTCCTGAACTTGAACGGTCCGTTCTGATTACGGTGGTCTATTTATAGTGGTGGAGGAGCTGGTAGGCATCTTGCACTGGCAGTC
CCACGAGGTTATCCGAGAGACTCAATTGGAACGAACTTGTAGATGGCTCCATCATTGCGCATTCGAACATCGAATTGGCCTTCCGTAAGTCGTTTTGGTGTCTTGAGCTTTAGACCTGGC
GGATGTTGACTACTTGGCCCCTCGATTACAGCGGCTAATGGCGGCCTCACCGACACCATCGAAGCCCTCCGCGCGGTCGGTATCAACCACGGTGTCTCTTTCGGCGATCTGTAAGGGAAC
CCTCTCATCACTTTCACAATGACAGAGTTCTGACACTTCATCTGCTCTATCACTGTAGCATCCAATTCGCCACTGCCGTCGGCATGTCCAACTGCCCTGGCTCTCCCCGACTTGAGTTCT
TGACGGGCAGGAGCAACAGTTCCCAACCCTCCCCTCCTTCGTTGATCCCCGGTCCCGGAAACATTGTCACTGCCATCTTGGATCGTATGGGCGATGCAGGCTTCAGCCCTGATGAAGTCG
TTGACTTGCTTGCTGCGCATAGTTTGGCTTCTCAGGAGGGTTTGAACTCGGCTATCTTCG
TACGTTTTCTTGTGTGCGTTGTTATGAATTGGTGTTAACACTGAAATAGAGGTCTCCTTT
GGACTCGACCCCTCAAGTTTTCGATACCCAGTTCTACATTGAGG
TGCGTCGGGTGTTTATGTAATCCACGAATTTCTCAAACTCATGAATGTCATGCAGACCTTGCTCAAGGGTACCACT
CAGCCTGGCCCTTCTCTCGGCTTTGCAGAGGAGCTCTCCCCCTTCCCTGGCGAATTCCGCATGAGGTCCGATGCTCTATTGGCTCGCGACTCCCGAACCGCCTGCCGATGGCAATCCATG
ACCAG
TCAGTTCCCTCTCCTTTGGTCCGTCTAGCCTGGCCAAAATTCTAATTTTTGTGACCGACAGGCAGCAATGAAGTTATGGGCCAGCGATACCGCGCCGCCATGGCCAAGATGTCTG
TTCTCGGCTTCGACAGGAACGCCCTCACCGATTGCTCTGACGTTATTCCTTCTGCTGTGTCCAACAACGCTGCTCCTGTTATCCCTGGTGGCCTTACTGTCGATGATATTGAGGTTTCGG
TAAGTTTCCAGTCGGTTTCTTGCAGTTAACAGGTGTTGATGAAGCGCTATAGTGCCCGAGCGAGCCTTTCCCTGAAATTGCTACCGCCTCAGGCCCTCTCCCCTCCCTCGCTCCTGCTGT
GAGTACTTCCTTTTTGGGTGATCTGACAGTACCTGACGTCACTTTCAGCCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGCTTTTGTCCACCTTCGCTGCTGTCATCATCGGTGCCCTCGCTCTCCCCCAGGGTCCTGGAGGAGGCGGGTCAGTCACTTGCCCCGGTGGACAGTCCACTTCGAACAGC
CAG
GTGCTGCGTCTGGTTCGACGTTCTAGACGATCTTCAGACCAACTTCTACCAAGGGTCCAAGTGTAGAGCCCTGTTCGCAAGATTCTTAGAATTGTTTTCCATGACGCGATCGGATTT
TCGCCGGCGTTGACTGCTGCTGGTCAATTCGG
GGTGGAGGAGCTGGTGGCTCCATCATTGCGCATTCGAACATCGAATTGGCCTTCCGGCTAATGGCGGCCTCACCGACACCATCGAAGC
CCTCCGCGCGGTCGGTATCAACCACGGTGTCTCTTTCGGCGATCTG
ATCCAATTCGCCACTGCCGTCGGCATGTCCAACTGCCCTGGCTCTCCCCGACTTGAGTTCTTGACGGGCAGGAG
CAACAGTTCCCAACCCTCCCCTCCTTCGTTGATCCCCGGTCCCGGAAACATTGTCACTGCCATCTTGGATCGTATGGGCGATGCAGGCTTCAGCCCTGATGAAGTCGTTGACTTGCTTGC
TGCGCATAGTTTGGCTTCTCAGGAGGGTTTGAACTCGGCTATCTTCG
TCTCCTTTGGACTCGACCCCTCAAGTTTTCGATACCCAGTTCTACATTGAGGCCTTGCTCAAGGGTACCACTC
AGCCTGGCCCTTCTCTCGGCTTTGCAGAGGAGCTCTCCCCCTTCCCTGGCGAATTCCGCATGAGGTCCGATGCTCTATTGGCTCGCGACTCCCGAACCGCCTGCCGATGGCAATCCATGA
CCAG
CAGCAATGAAGTTATGGGCCAGCGATACCGCGCCGCCATGGCCAAGATGTCTGTTCTCGGCTTCGACAGGAACGCCCTCACCGATTGCTCTGACGTTATTCCTTCTGCTGTGTCCA
ACAACGCTGCTCCTGTTATCCCTGGTGGCCTTACTGTCGATGATATTGAGGTTTCGG
GCCCGAGCGAGCCTTTCCCTGAAATTGCTACCGCCTCAGGCCCTCTCCCCTCCCTCGCTCCTG
CTGTGAGTACTTCCTTTTTGGGTGATCTGACAGTACCTGACGTCACTTTCAGCCTTGA

Retrieve as FASTA