Entry information : PpaPrx08 (PP00055G00690)
Entry ID 243
Creation 2008-08-05 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx08 (PP00055G00690)
Name (synonym) PpaPrx08 (PP00055G00690)
Class Class III peroxidase    [Orthogroup: Prx172]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type Protonema
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx08
start..stop
S start..stop
PpaPrx16 366 2e-127 1..321 1..325
PpaPrx10 358 4e-124 8..321 16..328
PpaPrx03 355 4e-123 1..321 1..325
SmPrx35-1_84 339 6e-117 14..321 12..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 774662..774886 225 N° 2 775037..775216 180 N° 3 775313..775900 588  
join(774662..774886,775037..775216,775313..775900)


exon

Literature and cross-references PpaPrx08 (PP00055G00690)
Literature www.cosmoss.org
DNA ref. Phytozome 11:   scaffold_55 (774662..775900)
Cluster/Prediction ref. UniGene:   Ppa.5966 [5' end]   Ppa.13422 [3' end]
Protein sequence: PpaPrx08 (PP00055G00690)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (303)
PWM (Da):   %s   35411.7 (32551.1)  
PI (pH):   %s   4.74 (4.65) Peptide Signal:   %s   cut: 28 range:28-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESAAGRTQRALAVWLVIAQLLQIVAAQDLQVDFYGGTCPSAEKIVRDAVEAAVAKDHGNAPGLIRLHFHDCFVRGCDASVLLDGPKSEKVASPNFSLRGFEVVDAAKAELEKQCPGIVSCADILAFAARDSIELTGGKRWEVPAGRRDGNVSINAEAEAMLPSPQLNVQQLTDSFTRKGLSQSDMITLSGAHTIGRIHCSTVVARLYPETDPSLDEDLAVQLKTLCPQVGGSSSSTFNLDPTTPELFDNMYYSNLFSGKGVLQSDQILFESWSTKLPTMFNVLSTTSFTSSFADSMLTMSQIEVKTGSEGEIRRNCRAVNPVVEAPSPL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 20 ESTs. No overlap between the 2 Unigenes.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCAGCCGCAGGAAGAACACAGAGAGCACTGGCAGTCTGGTTGGTCATTGCGCAGCTGCTGCAGATAGTGGCAGCGCAGGACTTGCAAGTGGATTTCTATGGTGGGACCTGTCCT
TCGGCGGAGAAGATAGTGAGAGACGCTGTGGAAGCTGCCGTGGCGAAGGATCATGGCAATGCGCCGGGCCTGATTCGTCTCCACTTTCATGACTGCTTCGTGCGA
GTAAGAGTTTGGCGA
ACCAGCGTCGGCATTTTTATATTTACAATTTTGGCCTCTCCACGAAGCTAAGACTTTCTTGTGTGGATTTTCTCGATGAATAATGTATACTGCACTATTAAAATTATCAAACTTGTGGAA
GTTGCGTTTGATTAGGGGTGCGATGCGTCAGTCCTTTTGGACGGACCGAAATCGGAGAAGGTGGCGTCGCCCAACTTTAGCTTGCGAGGATTCGAAGTTGTAGACGCGGCCAAAGCAGAG
CTCGAGAAACAGTGTCCTGGAATCGTTTCCTGCGCCGACATTCTTGCCTTTGCCGCTCGTGATTCCATTGAATTG
GTACGTGAAAGTTTTCAACTCCATCAGAAGATTTTGAATAGCTGC
TAGATCGACTGTTCGTAGGGATGATCCAACTGTTTTGTGGTGATTGAGCAGACTGGCGGAAAGAGATGGGAGGTTCCTGCGGGTAGACGAGACGGCAACGTGTCCATCAATGCCGAGGCA
GAAGCAATGCTGCCGAGCCCGCAGCTCAATGTGCAACAGTTGACTGACAGCTTCACTCGCAAAGGATTATCTCAAAGCGATATGATCACATTATCGGGTGCGCACACGATTGGTCGAATC
CATTGTTCGACCGTCGTGGCGAGATTGTATCCTGAGACAGATCCCAGCCTCGACGAGGATTTGGCTGTGCAGTTGAAGACCCTCTGTCCTCAAGTCGGCGGGAGTTCATCCTCAACCTTC
AACTTGGATCCCACGACGCCAGAGCTCTTCGACAACATGTACTACTCGAACCTCTTCAGCGGCAAGGGAGTTCTGCAATCGGACCAGATTCTGTTCGAAAGCTGGTCCACGAAGCTTCCT
ACAATGTTCAACGTCTTGTCCACAACATCGTTCACTTCGTCATTTGCAGACTCCATGCTCACCATGAGTCAGATCGAAGTGAAGACGGGCTCAGAGGGCGAGATTCGTCGCAACTGTAGG
GCTGTGAATCCCGTGGTGGAGGCCCCTTCTCCTTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCAGCCGCAGGAAGAACACAGAGAGCACTGGCAGTCTGGTTGGTCATTGCGCAGCTGCTGCAGATAGTGGCAGCGCAGGACTTGCAAGTGGATTTCTATGGTGGGACCTGTCCT
TCGGCGGAGAAGATAGTGAGAGACGCTGTGGAAGCTGCCGTGGCGAAGGATCATGGCAATGCGCCGGGCCTGATTCGTCTCCACTTTCATGACTGCTTCGTGCGA
GGGTGCGATGCGTCA
GTCCTTTTGGACGGACCGAAATCGGAGAAGGTGGCGTCGCCCAACTTTAGCTTGCGAGGATTCGAAGTTGTAGACGCGGCCAAAGCAGAGCTCGAGAAACAGTGTCCTGGAATCGTTTCC
TGCGCCGACATTCTTGCCTTTGCCGCTCGTGATTCCATTGAATTG
ACTGGCGGAAAGAGATGGGAGGTTCCTGCGGGTAGACGAGACGGCAACGTGTCCATCAATGCCGAGGCAGAAGCA
ATGCTGCCGAGCCCGCAGCTCAATGTGCAACAGTTGACTGACAGCTTCACTCGCAAAGGATTATCTCAAAGCGATATGATCACATTATCGGGTGCGCACACGATTGGTCGAATCCATTGT
TCGACCGTCGTGGCGAGATTGTATCCTGAGACAGATCCCAGCCTCGACGAGGATTTGGCTGTGCAGTTGAAGACCCTCTGTCCTCAAGTCGGCGGGAGTTCATCCTCAACCTTCAACTTG
GATCCCACGACGCCAGAGCTCTTCGACAACATGTACTACTCGAACCTCTTCAGCGGCAAGGGAGTTCTGCAATCGGACCAGATTCTGTTCGAAAGCTGGTCCACGAAGCTTCCTACAATG
TTCAACGTCTTGTCCACAACATCGTTCACTTCGTCATTTGCAGACTCCATGCTCACCATGAGTCAGATCGAAGTGAAGACGGGCTCAGAGGGCGAGATTCGTCGCAACTGTAGGGCTGTG
AATCCCGTGGTGGAGGCCCCTTCTCCTTTGTAA

Retrieve as FASTA