Entry information : AtGPx04 (At2g48150 / ATGPX4 / GPX4)
Entry ID 2474
Creation 2006-06-14 (Marcia Pinheiro Margis)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtGPx04 (At2g48150 / ATGPX4 / GPX4)
Name (synonym) AtGPx04 (At2g48150 / ATGPX4 / GPX4)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Siliques
Inducer Auxin treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtGPx04
start..stop
S start..stop
AlyGPx04 348 2e-125 1..170 1..170
BnGPx04_other 332 4e-119 1..170 1..170
BnGPx05_other 306 1e-108 1..169 1..169
ThasGPx04 305 2e-108 1..170 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19689046..19689099 54 N° 2 19688869..19688945 77 N° 3 19688740..19688801 62 N° 4 19688531..19688649 119
N° 5 19688225..19688392 168 N° 6 19688109..19688141 33  
complement(join(19688109..19688141,19688225..19688392,19688531..19688649,1968874 0..19688801,19688869..19688945,19689046..19689099))


exon

Literature and cross-references AtGPx04 (At2g48150 / ATGPX4 / GPX4)
Literature Rodriguez Milla M.A., Maurer A., Rodriguez Huete A., Gustafson J.P. Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways. Plant J. 36:602-615(2003).
Protein ref. UniProtKB:   Q8L910
DNA ref. Phytozome 11:   Chr2 (19689099..19688109)
Cluster/Prediction ref. Phytozome Gene 11:   19640474 UniGene:   At.36287
Omic ref. ePlant:   At2g48150 TAIR:   At2g48150
Protein sequence: AtGPx04 (At2g48150 / ATGPX4 / GPX4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19216.83  
PI (pH):   %s   9.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASASVPERSVHQFTVKDSSGKDLNMSIYQGKVLLIVNVASKCGFTETNYTQLTELYRKYKDDFEILAFPCNQFLYQEPGTSQEAHEFACERFKAEYPVFQVRVNGQNAAPIYKFLKASKPTFLGSRIKWNFTKFLVGKDGLVIDRYGTMVTPLSIEKDIKKALEDA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 4 introns), 4 cDNAs and 4 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAAGATGT GGCTCCGCCT TGGGGAACTG AAAACTGCAC ACACACTGAT CAAGCTGATA ATACAAAGGT TTCCAATTGT CAGCTTGGAC AGCAGCATCG GCCCGTCTTT GGCACTTCAC  ATCAGCATAT GTCCTTGTCA TCTCCACCAC TGCCATCTTC CTCGCCACCA CCGCCACCAG CTCCCCCTTC ACAGCAGGGG GAGTGTGCCA TGCCTGATTC CTACTTGAAT GGGTTTGAAA  ATGGAGGATA TCGCAACGTG CATGTACGTT TGTTTGTTGT AAAATCGTTT TACAAGAAAG ATGATGATAT ATCTTGATAT GGTCACTTAT CCTATTGTTA TTGGTAAATA TGCAGGGAGA  TCAACAGGCT GGTCCTCTTA GGATGAACCC GCCACTGTCT GGAAGCACAA TGCATTATCA AGGTCCGGAG TCGTCTTATA TTTCTGGTGT ACAACTTACG AATAGTATTC CACAGGCAGA  TGGTTCTAAT TTCCAGCATA GGCCTTATCC CTCTCATCCT CATCCACATC CTCCTCCCCC TCCACCGCCA CCACAGCATC AATTCTCATT TAGAGAGCCG GGCCACGTTT TGAAGTCGCA  TAGGGACGCT CCATCGTACT CCCACAGATC TCATTATGTG CCGAATTGTG ATGAAAGAAA TTTTCATGAT AACCATGAGA GAATGAGGCA TGCACCATTC GAGAATAGAG ATAATTGGAG  ATATCCACCA TCTTCTTCTT ATGGTGAGGC CTTTTACAGT CATGCGTGTG TTAATTATAT ATATATATAT ATATATGCTT TCTAATGTAA TGATGCGGGA ATGGGAAGTC TGATATGATC  GTCTCCTCGC AGGTTCGAGA TATCAAGATG AACACAAAGC TCCTTATCCA TCCAGTTCAT ACAATGGTGT CCGGTGGGAT AATCCTCCTC GCCAATATAA TAACAGACCC TCTTTTCATC  CGAAGCCGCA TTCTGAAGGT CCTGCTCCAG TTGGAATGAG AGGTAAGGAG GTTGGAGACG TTTATAATCC TTGGCCTTGT AAGTATTTAA GTAGTTTCCT TGCTATCGAG GAACCCACTC  GTGCTCAGAA TGAACAACCG TAGGGACATG AAAGGCTAAT TATTTTACTC ATCTTCTAGT GAGCCATGCG CAACATTCAT ATGGTAGGAT ATAAATTTTA GTGGAATCAT ATTATAGGTC  GTTTTCTGAC ATTTGAGGTT TATTTGGCAT TTAATGATGA AGTAATATAG GGAATAACCC CGAGTATCAT TTGTTTATTT GCAGATCCGG GAATGTGGCA TCAGAGAAGT GACTAGAGAA  ACTTGAGAGA GTTATAAACT GGTAAACGAA GAGGGTGGTG TGAAGCAAAA AAGCCAAAAC ACCGAGGTGA TGTGGCTCTA ATTTAAAAAG AGAACGGTTA TGTTGTTGAG GTGAAATAGT  GATATGATAA AGAAGTGAGA GTGTACATAC ATGATTTCGG AATCAGAATC ACATGCAATG CAGATTGTGA GGAGATGGTT AAAAAAAAGA AAGCCATTTG TAGAGATCGA GTTAGTATTT  ATATGCACTC CTTTGCTTAT TCATTGTTTT TTTTTTTTGT GTCAACATTA TTTTGTTATG TGGGTTTTGA CCTTGAAGTG TATGATGTAT ATCAGTATAT TCATCTCTTA TAATAATATT  CCTACTAAAA AGTTGGTTTT TTCTTTTTTG AAATGGAATG ATAGGGACTT TTCTCTTGAA TATAGTACAG ACTAGAGAGA GAGAGAGAGA GAGATTGTTG AGAATACTTT CAATTTTTTT  TTCTATAATA AGGCAATAAT GCAATTTCAC ATTTATGTAA GAATGAAGTA AAAAGGAGAG AAGACTAGAA AAACAAGGAG GAAGTCTTTC CCTTTAAAAA GGGTCAAAGA GGGTTCCTTA 
AATAAAAGGT TGGTTCCTCG TGAGAGAAAG TCTTTCCCTC TAATTTCTCT AGAGAGACAG AGAGAGAGAG ATAGCTAGAG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAACAACAGA CGAGATTGCC AATTAACAAT CACGGTTAAT TTTGTAATGT AAATTGCAGC TTTTATGTCG AAATTTCTTT TTGGACATGT TTCTCTGTTT AGTGTATAAA AAAAGAATTC  CTTTTGGAAG AGTAGGTTGC TGTTTTCAAA TTTTTTTTCC AAAAACTATT CTTAATGTTC CGGAGTTAAT GATCGTTATT GATTGATACA CCACCGACTC ATAATTAATT TTAGAAATTA  GGGATGCATC TTTATTTGTA TACCAATTAC CAAACACTCT ATATATCAAA TAAAAAGAAA CACTCTATAG AGAATGGCGA CCAATCTCCC CGTTTATTCA TCATCTTCAA TAACCTAACA  TGATATCTAA CACTCTGTTA GCCATCATGT TAGGTTAAGC CAAGAAATTT GAACACATAA TAGAAAGAAT AAAACAGAAG AGAAGAGCTA ACGACATTTT AGACATTTTA AATTTCCAAT  ATATCGCGGC AAACCAAAAA AAAGAAGAAG AAAAATACAT GCATGACAGG CATTTTTTGA AATAATTTAT CAGAGTATTG AAATAGTATT TTTTTTGCTG AAATCATGTG TAAAAATGAA  CTCGTAATGA AAATATCTGA CAACACATGC ATAACAGGTT AAAGACTTTA CACGTCGATT GGGCTTATAA GTTCAACAGG ATAAGAGATA TGAAAAGCAA CGGGAGAAAT GGAGAAGTAG  AAGATTGAGC GAGGCCGGTG GGTTGCATGG GCTGATCTAC GGGTCGAATT CCTGATTTAG TTGTGGGTCC CGTTGGTCCA TCCGCGGGAG TATCCGGTGC AGGTGCCTGT GTTGGTGTTG  TCCCCGCCGC CTTGGACGCT GATCAAGTGT GTCCAAAAGA AAATCAAACC CTAAACCTTA AACGCATAAC AATAAATATG ATTGTCGTAG CTAAATTACT TACCTCCCGG GCTAAAAGCA 
GACACCTGAG GTGGTGGAGC AATCAAAAAT GGAACCTGAC C 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCTGCTTCGGTTCCCGAGAGATCCGTCCATCAATTCACTGTAAAGGTATTCTCTTTTCGCTCATACTAGAGGAGGAGGTTGCATCGGCGCTGTGATATTTGTTTATTCCTT
ATCGTTGTTGTTGCTGTTGTTTCCTGGGAATTAGGATAGCTCCGGCAAGGACCTGAATATGAGCATTTACCAAGGGAAAGTCCTCCTCATCGTCAATGTTGCTTCCAAATGGTTCGTCTC
TTTTGTTCTTTTGCTATTTTCTTATTCACCTCTAATCCTTAGTTTTGTGCGCAAACAGCGGTTTCACCGAAACAAACTATACACAGCTCACCGAACTTTACCGGAAATACAAGGACCAAG
GTCATTGATTATATTACGGCCTTTTTTGTTATGCAGTTGCAAGCTCATCTCCTTTGTTGGTTTTACCATTTCATGCTCTCTCGTTTTCAGATTTTGAGATCTTGGCATTCCCTTGCAACC
AGTTTCTATACCAGGAGCCCGGCACAAGTCAAGAGGCTCATGAATTTGCCTGCGAACGCTTTAAGGCCGAATACCCTGTTTTCCAAAAG
GTACGTAGGGATCAAGACTCTTGGAACAAGT
TTATTATCTTATTATGTTAGGCTGCTGTGACTTGTGGTATGTTCGTTTATAACAAGAAATTCATAAACATGCACTTAACAAGTCTTGATTTGTGAATGTTGGGTTAGGTACGCGTAAACG
GTCAAAACGCAGCACCAATCTATAAATTCCTTAAGGCAAGTAAACCCACCTTTCTGGGTTCCAGAATTAAGTGGAACTTCACCAAGTTCTTGGTCGGCAAAGATGGCTTAGTGATTGATC
GTTATGGCACGATGGTTACACCGCTATCAATCGAG
GTATCCGTTCTTTATATATCCAAAGTACCCATGTAATAAATGTTGTCATTGTCAGTGATCCGATTTCCTTCTTTTGTTAGCAGAA
AGACATCAAGAAAGCTCTTGAAGACGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCTGCTTCGGTTCCCGAGAGATCCGTCCATCAATTCACTGTAAAGGATAGCTCCGGCAAGGACCTGAATATGAGCATTTACCAAGGGAAAGTCCTCCTCATCGTCAATGTT
GCTTCCAAATG
CGGTTTCACCGAAACAAACTATACACAGCTCACCGAACTTTACCGGAAATACAAGGACCAAGATTTTGAGATCTTGGCATTCCCTTGCAACCAGTTTCTATACCAGGAG
CCCGGCACAAGTCAAGAGGCTCATGAATTTGCCTGCGAACGCTTTAAGGCCGAATACCCTGTTTTCCAAAAG
GTACGCGTAAACGGTCAAAACGCAGCACCAATCTATAAATTCCTTAAG
GCAAGTAAACCCACCTTTCTGGGTTCCAGAATTAAGTGGAACTTCACCAAGTTCTTGGTCGGCAAAGATGGCTTAGTGATTGATCGTTATGGCACGATGGTTACACCGCTATCAATCGAG
AAAGACATCAAGAAAGCTCTTGAAGACGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGTTGGTTC CTCGTGAGAG AAAGTCTTTC CCTCTAATTT CTCTAGAGAG ACAGAGAGAG AGAGATAGCT AGAGATGGGT GCTTCTGCTT CGGTTCCCGA GAGATCCGTC CATCAATTCA  CTGTAAAGGA TAGCTCCGGC AAGGACCTGA ATATGAGCAT TTACCAAGGG AAAGTCCTCC TCATCGTCAA TGTTGCTTCC AAATGCGGTT TCACCGAAAC AAACTATACA CAGCTCACCG  AACTTTACCG GAAATACAAG GACCAAGATT TTGAGATCTT GGCATTCCCT TGCAACCAGT TTCTATACCA GGAGCCCGGC ACAAGTCAAG AGGCTCATGA ATTTGCCTGC GAACGCTTTA  AGGCCGAATA CCCTGTTTTC CAAAAGGTAC GCGTAAACGG TCAAAACGCA GCACCAATCT ATAAATTCCT TAAGGCAAGT AAACCCACCT TTCTGGGTTC CAGAATTAAG TGGAACTTCA  CCAAGTTCTT GGTCGGCAAA GATGGCTTAG TGATTGATCG TTATGGCACG ATGGTTACAC CGCTATCAAT CGAGAAAGAC ATCAAGAAAG CTCTTGAAGA CGCTTGAAAA CAACAGACGA  GATTGCCAAT TAACAATCAC GGTTAATTTT GTAATGTAAA TTGCAGCTTT TATGTCGAAA TTTCTTTTTG GACATGTTTC TCTGTTTAGT GTATAAAAAA AGAATTCCTT TTGGAAGAGT 
AGGTTGCTGT TTTC 

Retrieve as FASTA