Entry information : AtGPx05 (At3g63080 / ATGPX5 / GPX5 / MEE42)
Entry ID 2475
Creation 2006-06-14 (Marcia Pinheiro Margis)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: AtGPx05 (At3g63080 / ATGPX5 / GPX5 / MEE42)
Name (synonym) AtGPx05 (At3g63080 / ATGPX5 / GPX5 / MEE42)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Roots
Siliques
Inducer Auxin treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtGPx05
start..stop
S start..stop
AlyGPx05 325 2e-116 1..173 1..173
BrGPx05_other 319 8e-114 1..172 1..170
BnGPx05_other 316 1e-112 1..172 1..170
ThasGPx04 305 1e-108 1..171 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23310161..23310220 60 N° 2 23310314..23310390 77 N° 3 23310479..23310540 62 N° 4 23310680..23310798 119
N° 5 23310910..23311077 168 N° 6 23311165..23311200 36  
join(23310161..23310220,23310314..23310390,23310479..23310540,23310680..23310798 ,23310910..23311077,23311165..23311200)


exon

Literature and cross-references AtGPx05 (At3g63080 / ATGPX5 / GPX5 / MEE42)
Literature GENE FAMILY, NOMENCLATURE, TISSUE SPECIFICITY, AND INDUCTION.
DOI=10.1046/j.1365-313X.2003.01901.x; PubMed=14617062 [NCBI, ExPASy, EBI, Israel, Japan]
Rodriguez Milla M.A., Maurer A., Rodriguez Huete A., Gustafson J.P.;
"Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways.";
Plant J. 36:602-615(2003).
Protein ref. UniProtKB:   Q9LYB4
DNA ref. Phytozome 11:   Chr3 (23310161..23311200)
Cluster/Prediction ref. Phytozome Gene 11:   19660586 UniGene:   At.43439
Omic ref. ePlant:   At3g63080 TAIR:   At3g63080
Protein sequence: AtGPx05 (At3g63080 / ATGPX5 / GPX5 / MEE42)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   19201.86  
PI (pH):   %s   9.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASSSSSVSEKSIHQFTVKDSSGKEVDLSVYQGKVLLVVNVASKCGFTESNYTQLTELYRKYKDGFVVLAFPCNQFLSQEPGTSEEAHQFACTRFKAEYPVFQVRVNGQNAAPVYKFLKSKKPSFLGSRIKWNFTKFLVGKDGQVIDRYGTTVSPLSIQKDIEKALAQEL*

Retrieve as FASTA  
Remarks Sequence from 5 cDNAs and 9 ESTs (UNIGENE At.43439)
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGATTCTGC ATACCTCCAA TACTTAGGGA TGAAGACGAA GGAAGTGACT CGGATGGGGG TGATTTTGAG TCTGTCACCC CTGAACACGA GTCAAGAAGC CTTGAAGAAC ATGTCACACC  GTCCATTACC GAAAGGCATA CCCGTATACT GGAAGATGTT GATGGTGAGC TTGAAATGGA AGACGTGGCT CCACCTTGGG AAGGTGGAAG CAGTGCTAGT GCGATCACAG ATCAAGCTGA  TAATAGAGAG TCTGCAAATT GTCTGCTTGT CCCTGGAACT TCACATCAGA ATGTTACCTC GTCATCTCCA CCAGCTCGCC CTTCGCAGAA TGCTCAGTTG GCAATGTCTA ATTCCTACTC  AAATGGCTTT GACTACCGCA GAAATCCCAG CATGCAGGTG CGTCCTTTTT CTTCTTTTAG AATCTTTTGC AGTTAACAAA GTGAGGATTC AGACATAGTT AATAACTTAA TTTGTGGTTA  ATATTCAAGG GCGACTATCA TGCCGGTCCT CCAAGGATGA ATCCCCCAAT GCATTACGGA AGTCCTGAAC CATCTTATAG TTCCCGAGTA TCTTTGTCAA AAAGCATGCC ACGTGGGGAG  GGTTCTAACT TCCAGCATAG GCCATATCCA TCTTCTCATC CCCCACCTCC TCCGCCATCA CATCATTATT CATATATGGA GCCGGACCAC CATATAAAGT CGCGGAGAGA AGGTCTATCA  TACCCTCACA GATCTCATTA CACACTGGAA TTTGACGAAA GGAATTATCA AGACAGCTAT GAGAGAATGA GGCCTGAACC ATGCGAGAAT CGAGACAATT GGAGATATCA TCCGCCCTCT  TCTCATGGTG GACTCCGATA CCTTTTTTTT TTTTTTCCTT ATAATTCTCA TGCATGCTAA TAGGCATATA TGAATGCATA TATGAATGCA TATCTGCGCA CACAAGCACT TGCTCATGGA  TGCTAATAGG CGTGAATGCT TTTCTTTTTT TTATATTGCA GGTCCACGAT ATCATGACAG ACACAAAGGA CCTCATCAAT CGAGCTCATA CAGTGGGCAT CACCGTGACT CAGGAAGGTT  GCAGAACAAT AGGTGGAGTG ATTCTCCGCG TGCATATAAC AATAGACACT CTTATCACTA TAAGCAGCAT TCGGAAGGTC CTGTTCCAGT AGGAATGAGA GGTAATATGG AAATTCATAC  TTGTTCCACG TCATGAATCA GAGCCTTTTC TTATACTGGA ATTGTTTCCT AGGTTTAGAA ACTCTGACAT TTTCTTTTGA CTGGGGATTT TATATCATTA GGTCTCTGAG ATTCGAGATT  GTTTTGCTTG TCCTGTGGGT ATATCTTGAA TATAAAAATG AACTTGGAGT ATGTTTGTGG ATATGCAGAT CCAGGGACGT GGCATCAAAG GTGAGTGGGA GACAAGAGAT GAAGAAGGGC  AAAGGTGCAG TCTGCTCTAA ATGAAAGACA TTTGGGCTAT AGTCATGGAA AAGAAGAAAT AGGGAGAAAC AAGTGTAGGT TGGAAAGACC TGGGCCACTT GAGAGAGATG TTAATATACA  AAAGAAAAAA GGCACAGTTG GTGTGTGTAC ATATGACCAA AAACGTCGTG GAGAAGGCTA AAGAAACAGT CGTGAAAAGC CATTTGTTGT AGTAGAGAGA GAGAGATTTG AGTTAGGCAA  TACTGTCACT GATTTAGGCA TTTGATATTT TGTAAACAAA ATTTTTTGGT TTATTTTTGG GGAGTGGTGG TAATACACAC TAATATGCAT TTCTGTCACC TGGAGAGATG AGATGTCTCT  AAAAAATGGT CAAAGAGGCG ATTAATTAGT TAAATAGCAA ATGGAAAAAA CAATTAGGGA TGGGTTTGTT TGTTACCAAG GAATTAACAT AACAGCTGTA ATGCTGCTGC GAGATAAAAT 
GAACAATGAA GAAGCGGAGA CCTGTTGACT TCAAATAATT TTAATTAGTT TCTTCTGTGC GATAGAGATC GATCGAGAG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACACGCACAG AGATATTTGA CTCCTTTGGA AGAAACTTCT CTCATACTCT CGGTCATGCA GTCAAGTTTC TACATTTCCC ATTGCACCTT CCATATGGGC CTTGTATTCA TCTTATGTGT  AACTCTACTA GCCATTTCTT TTGTGAAATT TGATCAAAGG TGATTCCAAT AAGTTGATTT GAACCCATAA AAAAAAGAAA AAAAAAAACT AATTCCAACA AATACAAACC ACCAGCTAAG  CTAAAGATTA GACGAAATCA GCAAGATCAA AATAAAACAT CAATGATTTT CACTCAAGAG AACGCCTATA ACAACGTCTT AGGATACCAA AAGACATTTT AGTCTATCTA TCACTCTCAC  CATTTACTTT TTATGGTGCA AATTACTCAG TTTCGACGAT AATTAATGTT TAAATCTGTC TCATGTGTTC AATGAGAACT TCTTTCCATC TGTAATGTAT CGATTATAAG TGGCGTATCA  CTCTCACGTG CGCTGTTTGT GAAACGTGGC AGACAATTGA AGAAATAGAG AGTACAAAGG AGAAAAAAGG AGTACTTAAA AGGAGACCTT GACCACTCTT TCATGCATCC ATCCTTCTTC  TTTCTTGTCT TATCAGTTTC TTTTGCTTTT GTTAGAGATT AGTCAAACTA CTGATATTAT TAACATTAAC CATTTTTATG GCTTTATTTT GTGAACAAAC GACCCACCTA TCCCATAATC  ACTAATTAGA CATTACAACT AGTGTACTGT CTTTTCCATT TTATTTTTTC TCTGTGTATT ATATTTACAT TTTTTCTTCT TCTTCGATTA GCACTGGGTA TCCCGTCAAG AGTTTTCAAA  ACCGAAGATA GGGACCAATA CCAACTACTC CCGAAAGTGA GCAAGCCCCG AGCTTTCCTC CATGAGTCTA CGTGACCCGA ACAAAGCTAC TTAGTTTGGA GATTTGTGTA GAGCCCCGTC 
CTTTAGGTTC TGGCTCAACT ACCATTGCAC TGCCTTTTAT TT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCATCATCATCATCTGTGTCGGAGAAATCAATCCATCAATTCACCGTCAAGGTTTTCTAATTTATGAATCCCTTTTCTTCATTGTTTGTTTATCTGATGAATGAATGCGTT
TCTGACTTGTTTGTCTGATCTATCGGAAATTAGGATAGCTCCGGCAAGGAGGTTGACCTAAGCGTGTATCAAGGGAAAGTGCTGCTCGTCGTCAACGTCGCTTCTAAATGGTCCGTCAGA
TCCTCCGATCATCTTCTCTCTAGTTAATTATTATTTCTTGATTCTAAATTTTTTGTTAACAAACAATTTGGGGAACAGCGGATTCACGGAGTCCAATTACACCCAGCTGACGGAACTTTA
CCGGAAATATAAAGATCAAG
GTCAGACCATACAAGAATATTAGAATAGGAATGTATATATTCCTTTCTAATAAAGAAGACTCTTCTTCTTTTGCTTTCCCTTGTTACTTCATCGTTTATG
TAAGATTTTTTGTTTTGGTTTCCTTTGGATCATCATCAGGTTTTGTGGTATTGGCGTTTCCTTGCAACCAGTTTCTGTCCCAAGAGCCTGGCACCAGCGAAGAGGCTCATCAATTTGCTT
GTACTCGCTTTAAGGCTGAATACCCTGTTTTCCAAAAG
GTACCTCAACAAACAAGACACTTTTCTTCTTCATATGCCTTTAATAGGTAGCTGATTTTGTAAGTTTATAACTAAGCATGAA
TGATCATGATCATCTATGTGTGTGTGTAGGTGCGTGTAAATGGACAAAACGCTGCACCAGTCTACAAATTCCTCAAATCTAAGAAACCCTCTTTTCTTGGAAGTCGTATCAAATGGAACT
TCACCAAGTTCTTGGTCGGCAAAGATGGTCAAGTCATTGATCGTTATGGCACAACTGTTTCACCTCTATCCATCCAG
GTCTCTAACTCTCTTGTTCTTCATATTCTATTATAAAATCATA
TCACTCTTTTATGGCTTACTTCATGTTTGTTTTCTGCATAACAGAAAGACATCGAGAAAGCCCTTGCACAAGAATTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCATCATCATCATCTGTGTCGGAGAAATCAATCCATCAATTCACCGTCAAGGATAGCTCCGGCAAGGAGGTTGACCTAAGCGTGTATCAAGGGAAAGTGCTGCTCGTCGTC
AACGTCGCTTCTAAATG
CGGATTCACGGAGTCCAATTACACCCAGCTGACGGAACTTTACCGGAAATATAAAGATCAAGGTTTTGTGGTATTGGCGTTTCCTTGCAACCAGTTTCTGTCC
CAAGAGCCTGGCACCAGCGAAGAGGCTCATCAATTTGCTTGTACTCGCTTTAAGGCTGAATACCCTGTTTTCCAAAAG
GTGCGTGTAAATGGACAAAACGCTGCACCAGTCTACAAATTC
CTCAAATCTAAGAAACCCTCTTTTCTTGGAAGTCGTATCAAATGGAACTTCACCAAGTTCTTGGTCGGCAAAGATGGTCAAGTCATTGATCGTTATGGCACAACTGTTTCACCTCTATCC
ATCCAG
AAAGACATCGAGAAAGCCCTTGCACAAGAATTGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGTTGGTGTG TGTACATATG ACCAAAAACG TCGTGGAGAA GGCTAAAGAA ACAGTCGTGA AAAGCCATTT GTTGTAGTAG AGAGAGAGAG ATTTGAGTTA GGCAATACTG TCACTGATTT  AGGCATTTGA TATTTTGTAA ACAAAATTTT TTGGTTTATT TTTGGGGAGT GGTGGTAATA CACACTAATA TGCATTTCTG TCACCTGGAG AGATGAGATG TCTCTAAAAA ATGGTCAAAG  AGGCGATTAA TTAGTTAAAT AGCAAATGGA AAAAACAATT AGGGATGGGT TTGTTTGTTA CCAAGGAATT AACATAACAG CTGTAATGCT GCTGCGAGAT AAAATGAACA ATGAAGAAGC  GGAGACCTGT TGACTTCAAA TAATTTTAAT TAGTTTCTTC TGTGCGATAG AGATCGATCG AGAGATGGGT GCTTCATCAT CATCATCTGT GTCGGAGAAA TCAATCCATC AATTCACCGT  CAAGGATAGC TCCGGCAAGG AGGTTGACCT AAGCGTGTAT CAAGGGAAAG TGCTGCTCGT CGTCAACGTC GCTTCTAAAT GCGGATTCAC GGAGTCCAAT TACACCCAGC TGACGGAACT  TTACCGGAAA TATAAAGATC AAGGTTTTGT GGTATTGGCG TTTCCTTGCA ACCAGTTTCT GTCCCAAGAG CCTGGCACCA GCGAAGAGGC TCATCAATTT GCTTGTACTC GCTTTAAGGC  TGAATACCCT GTTTTCCAAA AGGTGCGTGT AAATGGACAA AACGCTGCAC CAGTCTACAA ATTCCTCAAA TCTAAGAAAC CCTCTTTTCT TGGAAGTCGT ATCAAATGGA ACTTCACCAA  GTTCTTGGTC GGCAAAGATG GTCAAGTCAT TGATCGTTAT GGCACAACTG TTTCACCTCT ATCCATCCAG AAAGACATCG AGAAAGCCCT TGCACAAGAA TTGTGAACAC GCACAGAGAT  ATTTGACTCC TTTGGAAGAA ACTTCTCTCA TACTCTCGGT CATGCAGTCA AGTTTCTACA TTTCCCATTG CACCTTCCAT ATGGGCCTTG TATTCATCTT ATGTGTAACT CTACTAGCCA 
TTTCTTTTGT GAAATTTGAT CAAAGGTGAT TCCAATAAGT TGATTTGAAC CC 

Retrieve as FASTA