Entry information : PpaPrx07
Entry ID 248
Creation 2008-08-05 (Christophe Dunand)
Last sequence changes 2010-06-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx07
Name PpaPrx07
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx07
start..stop
S start..stop
PpaPrx33 496 6e-179 1..324 10..333
PpaPrx53 337 8e-116 8..324 12..335
PpaPrx13 337 8e-116 8..324 12..335
PpaPrx43 313 2e-106 12..324 16..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 609498..609725 228 N° 2 609096..609275 180 N° 3 608187..608753 567  
complement(join(608187..608753,609096..609275,609498..609725))


exon

Literature and cross-references PpaPrx07
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants.
DNA ref. Phytozome 12:   scaffold_25 (609725..608187)
EST ref. GenBank:   BJ173664 [3' end]
Cluster/Prediction ref. UniGene:   Ppa.1061
Protein sequence: PpaPrx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (296)
PWM (Da):   %s   34052.52 (31282.1)  
PI (pH):   %s   4.42 (4.40) Peptide Signal:   %s   cut: 29 range:29-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSIYQGGLVAALLAVAISLTCLSSHAEAQGLAVGYYTNSCPTVETIIYNSMWDSYTRDPTTAPGVLRLAFHDCFVRGCDASVLLDGVDSEKAAAVNVNLHGFDAIDAAKTAVEDACPGTVSCADILQYAARDSVLLTGGEGWDVSGGRRDGFTSSSADPPLELPLQTMTVPELLANFAAKNLNAAHMVALSGSHSIGVAHCQFIVDRLYNYPNSATGSDPSLPADLLEFLKTQCPDSAATPEINIDEVSPGTFDSQYFDNIIRNRGVIASDQHLMDHTSTQGEVAANNGPAFGGNFGRAMVVMARFNVLTGSAGQIRTNCRQVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 11 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATTTATCAAGGAGGTTTGGTGGCTGCCTTGTTGGCCGTGGCCATCTCATTGACGTGCTTAAGCAGCCATGCAGAGGCTCAAGGGCTTGCCGTCGGCTATTACACTAACTCCTGT
CCCACGGTAGAAACCATAATTTATAATTCAATGTGGGATTCGTACACTCGGGACCCTACAACCGCTCCTGGCGTTTTGCGCCTCGCATTTCATGACTGCTTCGTTCGT
GTGAGTTCCAAC
TCCATTGTTGTGTCTTTGTCTGTAAATTATGTCCTCCCATCAAATATGAAGTATGCATTAACTTCATCAACTGAACATGTTACGACACTCTAGGATTGTACGTCATGATCCTACGTGACC
AGCATCCCAAATTGGAAATTTTGTCGGTATAGAGTGTGGACATGTACTGGCTCATGTTGTGATTGACGAGCAACCTAAATTGCGTTCCAGGGCTGTGATGCTTCGGTGTTGCTAGACGGA
GTAGATTCGGAGAAAGCGGCGGCAGTCAATGTGAACCTGCATGGATTTGACGCTATAGATGCGGCTAAAACAGCGGTGGAGGATGCATGCCCAGGAACTGTTTCCTGCGCCGATATCTTG
CAGTACGCAGCTCGTGATAGTGTCTTGCTG
GTAAGTTGGTACTGATTTCTCCTCTGCATACGGTAGTCACTTCAAGAAATTCTTTATTCAATACCTGAAAGAGGGAGCTAGGACTACGCA
GTGGTAAGACGCTCTGTCGTCACGACACCAACTGTGCTCAGCATTGAGTAAAGATAGCAGCAAGACTGGTTGAATTTACCAGTTGACCTGTGACTTGGCTGTTCAACATTGCAAGAGAAT
TCAAATCTTGGTGAGAAAGAATCACAAGGAAGTCGAATTGTGAGCTTAATATATGCTTTACAGTGGTTAATGAAAATCAAGATTGTTGATGGCGTTACTGATGGGTTTACAATTTTGTCA
TGGCTATCGCAGACCGGAGGTGAGGGCTGGGATGTGTCTGGTGGGAGGAGGGATGGATTTACATCAAGTTCTGCAGATCCCCCTCTAGAGCTGCCTCTCCAAACCATGACAGTGCCCGAG
CTTCTTGCTAATTTCGCGGCCAAGAACTTGAACGCTGCACACATGGTCGCCCTGTCGGGCAGTCACTCAATCGGTGTTGCTCACTGCCAATTCATCGTTGATCGTCTATACAATTATCCC
AACAGTGCAACAGGATCCGACCCTTCCCTTCCAGCCGACCTCTTAGAATTCCTTAAGACACAGTGTCCTGACTCCGCCGCAACTCCCGAAATCAACATTGACGAGGTCTCCCCAGGCACC
TTTGACTCCCAATACTTCGATAACATCATCAGGAACAGGGGGGTGATAGCATCCGATCAGCACCTGATGGACCACACCTCCACCCAGGGCGAAGTGGCGGCCAACAATGGACCCGCTTTC
GGCGGCAATTTTGGTAGGGCAATGGTGGTTATGGCTCGGTTCAATGTTTTAACTGGATCTGCCGGTCAGATTCGTACCAATTGCCGACAAGTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATTTATCAAGGAGGTTTGGTGGCTGCCTTGTTGGCCGTGGCCATCTCATTGACGTGCTTAAGCAGCCATGCAGAGGCTCAAGGGCTTGCCGTCGGCTATTACACTAACTCCTGT
CCCACGGTAGAAACCATAATTTATAATTCAATGTGGGATTCGTACACTCGGGACCCTACAACCGCTCCTGGCGTTTTGCGCCTCGCATTTCATGACTGCTTCGTTCGT
GGCTGTGATGCT
TCGGTGTTGCTAGACGGAGTAGATTCGGAGAAAGCGGCGGCAGTCAATGTGAACCTGCATGGATTTGACGCTATAGATGCGGCTAAAACAGCGGTGGAGGATGCATGCCCAGGAACTGTT
TCCTGCGCCGATATCTTGCAGTACGCAGCTCGTGATAGTGTCTTGCTG
ACCGGAGGTGAGGGCTGGGATGTGTCTGGTGGGAGGAGGGATGGATTTACATCAAGTTCTGCAGATCCCCCT
CTAGAGCTGCCTCTCCAAACCATGACAGTGCCCGAGCTTCTTGCTAATTTCGCGGCCAAGAACTTGAACGCTGCACACATGGTCGCCCTGTCGGGCAGTCACTCAATCGGTGTTGCTCAC
TGCCAATTCATCGTTGATCGTCTATACAATTATCCCAACAGTGCAACAGGATCCGACCCTTCCCTTCCAGCCGACCTCTTAGAATTCCTTAAGACACAGTGTCCTGACTCCGCCGCAACT
CCCGAAATCAACATTGACGAGGTCTCCCCAGGCACCTTTGACTCCCAATACTTCGATAACATCATCAGGAACAGGGGGGTGATAGCATCCGATCAGCACCTGATGGACCACACCTCCACC
CAGGGCGAAGTGGCGGCCAACAATGGACCCGCTTTCGGCGGCAATTTTGGTAGGGCAATGGTGGTTATGGCTCGGTTCAATGTTTTAACTGGATCTGCCGGTCAGATTCGTACCAATTGC
CGACAAGTTAATTAG

Retrieve as FASTA