Entry information : PpaPrx09 (Pp1s306_39V6)
Entry ID 249
Creation 2008-08-05 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra)
Sequence status complete
Reviewer Toky Ramarohetra
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx09 (Pp1s306_39V6)
Name (synonym) PpaPrx09 (Pp1s306_39V6)
Class Class III peroxidase    [Orthogroup: Prx177]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx09
start..stop
S start..stop
PpaPrx18 415 1e-146 22..336 33..340
PpaPrx19 369 2e-128 7..329 5..323
TruPrx01 365 7e-127 8..331 6..329
WmPrx11 295 2e-99 9..326 10..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172828..173046 219 N° 2 172430..172624 195 N° 3 172154..172322 169 N° 4 171486..171913 428
complement(join(171486..171913,172154..172322,172430..172624,172828..173046))


exon

Literature and cross-references PpaPrx09 (Pp1s306_39V6)
Literature www.cosmoss.org
(search by Penel lab)
DNA ref. Phytozome 12:   scaffold_306 (173046..171486)
Cluster/Prediction ref. UniGene:   Ppa.16028 [3' end]   Ppa.2234 [3' end]
Protein sequence: PpaPrx09 (Pp1s306_39V6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (311)
PWM (Da):   %s   36574.73 (33871.1)  
PI (pH):   %s   5.84 (4.93) Peptide Signal:   %s   cut: 26 range:26-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAISRARARVVVALILVKFVILVNAQVLTTEFYDESCPEIYSIVKEEVQKAVEAEKRMAASLIRLHFHDCFVNGCDGSLLLDDPILGGTGEKLSRSNLNSTRGFEVIDTIKTRLESACPNTVSCADLLAIAARDSAVQVGLTDTYPVYFGRRDSLTASIDEANLRLPTPNSNYSVLKANFEFQGLDETDLIALSGAHTIGRVRCIVITVSNSSTDPNINAAFRDTLIKACDTANGTIDPPLQNLDVKTPDKFDNNYFKNLRRGEGVLTSDQTLQSTPGPNVGIVKDFAKNKENFFTQYGLSSIKMGYIRPLTGDQGEIRKNCRAVNSAPSSLVAYQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 90 ESTs. Contig also contains PpaPrx19 and PpaPrx14.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCTCGAGAGCTAGAGCGCGGGTTGTAGTGGCATTAATACTTGTGAAATTTGTCATCCTAGTCAACGCCCAAGTTCTCACCACTGAATTCTACGACGAGTCTTGCCCCGAAATT
TATTCCATTGTCAAAGAGGAAGTGCAGAAGGCGGTGGAGGCCGAGAAGAGGATGGCGGCTTCCTTGATTCGCCTTCATTTCCATGACTGCTTTGTCAAT
GTATGAACTCACAGAATTTCC
AGTGAAGGCAACATCTGTGATGCCAGAGTACATGATCCGTAACAAACTGAATATTCAACACAGAAGAGTATCCCTGTTTTTATGTCGTTGATATGTAAATGGTCGATCTGTGGTGTGCAC
TTCGATCGTGGTCAGAGCCCAGTTTGGTAGAAGAATGTACTAACTTTCGTGGGTTGTGGTAGGGATGCGACGGATCGCTTCTTTTGGACGATCCTATTTTGGGAGGTACTGGAGAAAAGC
TGTCACGTAGCAACTTAAACTCCACTAGGGGGTTTGAGGTGATTGACACCATCAAGACTCGGCTGGAGTCTGCATGCCCAAACACCGTCTCCTGCGCCGACCTCCTGGCTATCGCAGCTC
GTGACTCTGCTGTTCAG
GTACCACCATGTTTCTCAATCTATCCATAATACATCTGTAAGCTATCTCCTTGACCAAAGAAAAATTTCAGAACTTTTCACAGCGAGACTGTGGTTGAATGTG
TAAGGTTGGGTTGACCGACACCTATCCTGTGTACTTCGGTCGCCGTGACAGCCTGACCGCAAGTATAGATGAAGCCAACTTACGACTCCCAACACCGAACAGCAATTACTCCGTCCTGAA
GGCTAATTTTGAATTCCAAGGCCTTGATGAAACTGATCTCATCGCCCTATCAG
GTATCAGATTCTGTTCACTGATGTCTAACTACCACACATTTGGCACTCCGACAATGCTCAGACATTG
CTACGGGTGTCTCAGTGCCCACTACTTACTTTGAACACTGGCACAAAGATACAGCCGGCCATGCCAGTGGCACGACACTCGTTGCTAATTTCTGGTCAAATTCAGTTGTATTTTGTAGCA
GATAACCACGGATTTGACTGAAAGGTTGACCATTGCTTGGTATCCAATTGCAGGTGCTCACACAATCGGCAGAGTCCGATGCATAGTCATTACCGTGTCCAACTCATCGACAGATCCCAA
CATCAACGCCGCGTTTCGCGACACCCTGATTAAAGCCTGTGACACTGCCAATGGAACAATCGATCCCCCGCTGCAGAACTTGGACGTCAAAACGCCGGACAAGTTCGACAACAACTACTT
CAAAAACCTGCGCAGAGGGGAAGGTGTCCTCACCAGCGACCAGACGCTGCAAAGCACTCCAGGCCCCAACGTGGGCATCGTCAAGGACTTCGCCAAAAACAAGGAAAACTTCTTCACTCA
ATATGGGCTCAGCAGCATCAAGATGGGCTACATCAGACCTCTCACTGGAGACCAGGGAGAGATCCGAAAGAACTGCCGCGCCGTGAACTCGGCACCATCATCTCTCGTCGCTTATCAGTA
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCTCGAGAGCTAGAGCGCGGGTTGTAGTGGCATTAATACTTGTGAAATTTGTCATCCTAGTCAACGCCCAAGTTCTCACCACTGAATTCTACGACGAGTCTTGCCCCGAAATT
TATTCCATTGTCAAAGAGGAAGTGCAGAAGGCGGTGGAGGCCGAGAAGAGGATGGCGGCTTCCTTGATTCGCCTTCATTTCCATGACTGCTTTGTCAAT
GGATGCGACGGATCGCTTCTT
TTGGACGATCCTATTTTGGGAGGTACTGGAGAAAAGCTGTCACGTAGCAACTTAAACTCCACTAGGGGGTTTGAGGTGATTGACACCATCAAGACTCGGCTGGAGTCTGCATGCCCAAAC
ACCGTCTCCTGCGCCGACCTCCTGGCTATCGCAGCTCGTGACTCTGCTGTTCAG
GTTGGGTTGACCGACACCTATCCTGTGTACTTCGGTCGCCGTGACAGCCTGACCGCAAGTATAGAT
GAAGCCAACTTACGACTCCCAACACCGAACAGCAATTACTCCGTCCTGAAGGCTAATTTTGAATTCCAAGGCCTTGATGAAACTGATCTCATCGCCCTATCAG
GTGCTCACACAATCGGC
AGAGTCCGATGCATAGTCATTACCGTGTCCAACTCATCGACAGATCCCAACATCAACGCCGCGTTTCGCGACACCCTGATTAAAGCCTGTGACACTGCCAATGGAACAATCGATCCCCCG
CTGCAGAACTTGGACGTCAAAACGCCGGACAAGTTCGACAACAACTACTTCAAAAACCTGCGCAGAGGGGAAGGTGTCCTCACCAGCGACCAGACGCTGCAAAGCACTCCAGGCCCCAAC
GTGGGCATCGTCAAGGACTTCGCCAAAAACAAGGAAAACTTCTTCACTCAATATGGGCTCAGCAGCATCAAGATGGGCTACATCAGACCTCTCACTGGAGACCAGGGAGAGATCCGAAAG
AACTGCCGCGCCGTGAACTCGGCACCATCATCTCTCGTCGCTTATCAGTAA

Retrieve as FASTA