Entry information : AtGPx01 (At2g25080 / ATGPX1 / GPX1)
Entry ID 2499
Creation 2006-06-14 (Marcia Pinheiro Margis)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtGPx01 (At2g25080 / ATGPX1 / GPX1)
Name (synonym) AtGPx01 (At2g25080 / ATGPX1 / GPX1)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Chloroplastic
Tissue types Flowers
Green siliques
Hypocotyls
Leaves
Mixed tissues
Rosettes
Seedling shoots
Seeds
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtGPx01
start..stop
S start..stop
AlyGPx01 451 5e-164 11..236 11..236
BnGPx01_other 409 3e-147 4..236 1..236
ThasGPx01 370 6e-132 1..236 1..235
AtGPx07 357 6e-127 10..236 4..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10668134..10668388 255 N° 2 10668704..10668780 77 N° 3 10668875..10668936 62 N° 4 10669355..10669473 119
N° 5 10669546..10669713 168 N° 6 10669799..10669828 30  
join(10668134..10668388,10668704..10668780,10668875..10668936,10669355..10669473 ,10669546..10669713,10669799..10669828)


exon

Literature and cross-references AtGPx01 (At2g25080 / ATGPX1 / GPX1)
Literature Gachotte,D. and Benveniste,P(1996). The electronic Plant Gene Register. Plant Physiol. 110 (2), 713-714.
Protein ref. UniProtKB:   P52032
DNA ref. Phytozome 11:   Chr2 (10668134..10669828)
mRNA ref. GenBank:   X89866.1
Cluster/Prediction ref. Phytozome Gene 11:   19639809 UniGene:   At.24670
Omic ref. ePlant:   At2g25080 TAIR:   At2g25080
Protein sequence: AtGPx01 (At2g25080 / ATGPX1 / GPX1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   25928.3  
PI (pH):   %s   9.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSMTTSSSSYGTFSTVVNSSRPNSSATFLVPSLKFSTGISNFANLSNGFSLKSPINPGFLFKSRPFTVQARAAAEKTVHDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKTGFEILAFPCNQFGFQEPGSNSEIKQFACTRFKAEFPIFDVDVNGPSTAPIYEFLKSNAGGFLGGLIKWNFEKFLIDKKGKVVERYPPTTSPFQIEKDIQKLLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 5 introns), 5 cDNAs and 60 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGAATGTGT GTAATCGTCA TTGTAAACAG CAAAATTACA GAAGAATTTA ACTAGTTGTG TATTTGCTAT ATGTAGACCA TTAGTATTTT GTCATCTTAA CTTTCATATA AACTGGTTTT  GTCGTTGGCT AAAAGTATAT TAAAAATTTT AAACAGAAAA AGAGTATTAT GGTAGGATAA ATTGCAAAAA CAAATTAACA TATGCTAGTT TTTACCTGGC ATTTAACAAA ATTTATGATT  TCTGTTTTTA TATCGAACAT ACATAGTTTC ATGATACAAT CAATTTTTGC ACTTAGGTAT GTGAAGTAAT AGAAATGGAA GAAAAAAATA CAAGAAAAAG GAACTTCAGA AGATTTTTTG  TCTCCAAGTG AAAGCCGGTC CTTAGTTTTG AGAGGCTTGA AGCACAAAAA TAATTATGTG GTCTATCAAA TATTTACGAC TTAAATATTG TATTACAACA TTATTAACAT TTAAATATCT  TAAATAGCTA AAAATATAAT ATTTTTGACT TTCAATGAGG CAAGGAACTC TCGAGAGAGG TCTTCCTAGA CCCATGTTGG TGAAGATAGC TTCGACGTCT TCTAAAAGCA CCTCCATCGA  TTATATTAAC GAGTGTTTAT ACTATTTTTT TTTAATATAA ATTTGAAATA TTTGTGAAAG GAGAAAAGAG AAGAAACATA TGTTAAAGAC ACTTTTTACT TACATGTCAC TTTTTGATTG  GGTTTAATAT TTTTACAATT TATTGATTAA AATTTTAATC TAACTTAAGA CACTTCACTT TGATCACCGG TGCAGATACT TTAAGAGCCT CGCTTCACGA AGAAAAACCG AATCGGAATA  ACGAGTGGGA GTGAATTCGG TGAGCATGTA AGTATCACCC TCATCGCATA AAACCTCCTT AGCTTCAATT TCGAAAAGGG AATTGTTATA TACTGATTGA ACAAAATAAA GATATTCTAT  AGTAAACACA TGTTATATAG AACAACATTT GAGATTGATA TTGTAATAAT GGAGAGAGGT AGCTTCTAAT GAGTATACTA CTAAAGTACT AATAAGAAAA CTAAATTTGG CTGTCACATC  TTATCTATTT GTTTATGTGG CCCAACATTT CCAATATATA TTACAAAATA ATAATAATGG ATAGGCATTG CCACCGGTTA GATTATAACT CTTCGTTTGA GTGCGACATA TTTGTAACCA  GAGACAATAA TTAGGATAAG GATTGAACCA AGGAACTAAA CAAAAATTTG AGGATGAAAC ATAGTCCAAA ACAAAATCCA TTTAATTTTT GGGACAAGAA CATAGATATC ATAACACTTA  AATATGTGCC TCAAATTGGT CCAAAATGCT CTCGTGAATG AACGTGGATT TTGCACCACT CAACTTAATT ACTTACTTTG TCCCATTTAA AAAAAAAAAA TTATAAAAGC AAAAATATTA  AGGAAAATTT TTCATTATAA AAATATCATC TAATATTTTA ATTTAAAACC CTACCATAAA TCATAGAAAA TACTGCAGCA TATAAATAAT CATAAAATTA AATAGAATTT TACAGTGATT  TCATATAAAA TACTACAGAA GATAAATAAT CATAAAATAA ATATAATTTT GCAGTAATTT CATAGAATAA AATGCTCCAG AATTTAAGTA ATCATAAGAA ATCTAATAAG CATTTTGTAA  ATAAAAAAAT CCAACTTTGT CTCCAATTGA ATTCTGCAAA AAATCCAACT ATACTGCAAA ACAAATTCCA ATTATGTCTC CAAAACGAAT TTGAAAACAA ATTGTGAAGA AAAATATCAT  TATATTTTTT GTAAAGTAAA TAAAATTAAA AACACATTTA TGGTCCAAAA ATTTAGTTTT TTTTGTTTTT TTAGTTAATG TGTATTTTGG CATGATATAA AGTGCGTCGT GTCTCGACTA 
TATCATCTCT CGGTTTCACT ATTGAACGTG TAACACTGGT CGAAAGAAGA CGAACATAAA CTCGTCTCCG GTAACCAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAACTTTTGC TCATGAGTGA GCATATAGAG ACTGATGGTT AAAGTAACCG TAAATTGTGA CATAAAGTTT CCGGTTATTG CTTGTATACC TTCTTACATT CTAAGTTGTA CTAATCGCTT  AATAATTTGC GTATAATGGT AATGTTATAT ACATTATATT ATAAAAATGG TGTTATATAT ACAATAAGAC AATCTCGCTC GCGCACATCC AATCAACAAC GATGGAGATG ATATTACAAA  AAAAAGCATT GAACCCTTCA CCTCTTACAT TTCAAAGTGT TTATTAAACT AGATTAGTTA CAGTTCCTTA TGTAAAAATT CAAATATTTA TAGTTTAGTG GGTGCACCAA CGTGAGTCCG  CCCTACTTAA TCTTATATAC ATTATTTTAT TGAATTTGAA AAGTAATCCG CAATATAACC CTTGAACGTG TATAGATTTT GTAAACCGTA TAAGTTTGTA TATAGATTAA CAAAACTACT  TCGCTTTGAA CACTTGAAAA AAAAAAAAAA TGAGAAGTAG ACTCGAACTA ATGACCTATA GAACGTTCAT AACATATATA ACCAATTTTG CTTCAATAGT TTTTGACAAT TGTACAAACC  CTCCAAGTAA TTTTTATTGT TAATCATAAA AAAAATGTTC TTATACATTT GCAATTTCAC AATAAGACAG TCTCGCCTCG CACATCCAAT TCCAAAAAGT GAATTATTAC AGCTCATGAA  ACATTATTTA TTTTGTTATC ATTTGTGTCA ACATTATCAT TAGTGGTAAC ATCGTCTTCA TCATCATCAC CTTGCCATGA CCATACAATG TCTTTAAGAG CTGGTCTGAC GTCATCCTCA  CAGAAGAGGT AATACTCCAA CGTATCCCCC GAGGTTTTGC AGAACTCCAC GACAGAGACT TCAGGAGCGA CTTCGAATAC TTCCGCCGTC ACCGAGAGCC TTCCTTTACG ACCTTCTGTT 
CTTCTTTGCA GCTTCATCTT GCAGTCTTTT ACATGTTTCA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCATGACTACTTCATCTTCTTCGTACGGAACATTCTCTACAGTCGTCAACAGTTCTAGACCTAATTCCTCAGCAACCTTTCTCGTCCCTTCCTTGAAATTCTCCACCGGAATA
TCGAATTTCGCGAATCTGAGTAATGGGTTTTCTCTAAAATCTCCAATTAATCCTGGGTTTCTCTTCAAGTCTCGTCCTTTCACTGTCCAAGCTAGAGCTGCTGCAGAAAAAACCGTTCAC
GATTTCACCGTTAAG
GTTTGGTTCTTATTCTTTTACCCAATTCAGACCAAAAACTAGGGTTCTCTAAATTCTATCTGCTCTTTAGTAAATTGGGAATCTTCAACTTTGCAATGAAGTTCA
TAGTGATTTCAATTGAGACATACATAAAAATCTGAAATTTGAGACATAAGTGTATGGTGATTTCAACTTGATACATACTTAGATTCATATTTTTATTGAATTTCGTAGTGTATATTTATA
CTTTTTTTTTTTGAAAAAAGGTGTATATTTATACTTAGGTTAGTGATTTCAATTAGAGACATAATTAGATTGTTATTTTTATGGAGGCAGGACATTGATGGGAAGGATGTTGCTTTGAAC
AAATTCAAGGGGAAAGTTATGTTGATTGTCAATGTTGCTTCAAGATG
GTAAGCTTCTCCTTCTTCATCCTCTTGATGTGTTTGATGACAGTTCATGTAGAGGTTTCTAATCTTAAAGATT
GTGTGTTTTATGAACATACAGTGGTTTGACATCATCAAATTACTCAGAGCTTTCACATCTGTACGAGAAATACAAAACTCAAGGTGAGTTCTAATTAGTTCTCTCATATTGTGATCTATT
CCGGTTTGCAACCAGTGGGTATTTTGGTTACTTACTGAAAATTCCTCGTGTTTTGGTGTTCACTTAATTGTTCTGTAGATCTTTATATTATTGTGGTGTCAATATGATTTGGTTCTATTG
TTGCTTCTTCTACAGCGATGTTACTAGCTCGTAGTTCACTTTAATTTATGGAAATAAAATTGTTCTGTAACGTTGAACTGCAAGCAAATTCAGCATCTTTGTTTGATTGATGATAATCTC
ACTCATCCGTTCTCTGTAGCTAAAAGAATTTTCTCGAAAGTACGGATCTGTTCATTAATCATTTAGGAGGCAATAAGCCAATGAACGTGTATTTCTCATGCATTTGTAGTTAGTAATACT
AGCTTGTTGTTTGGATTACAGGATTTGAGATTCTAGCTTTTCCCTGCAATCAGTTTGGTTTCCAAGAGCCCGGGTCAAACTCCGAGATCAAACAATTCGCTTGCACCCGGTTTAAAGCAG
AGTTCCCTATATTTGATAAG
GTATAAAGAATCCAAAACATTCATTCTTCTTATTTTCAGGTTGCAGATTCTAAATAAGTTTGAATTCGACAGGTTGACGTGAATGGACCAAGCACAGCGC
CGATCTACGAGTTCTTGAAATCAAACGCAGGAGGATTCTTGGGTGGTCTCATTAAATGGAACTTTGAGAAGTTCTTGATTGATAAAAAGGGAAAGGTCGTTGAGAGGTACCCTCCCACCA
CATCCCCTTTCCAAATCGAG
GTATGGCTAATGGACTACTTCCTATTTGGTTCATAGCGGTTCTATTCCCGGTTTGTAACCAAACCGTTTTGTTTCTGTTTTGCAGAAAGACATCCAGAAG
TTGCTTGCCGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCATGACTACTTCATCTTCTTCGTACGGAACATTCTCTACAGTCGTCAACAGTTCTAGACCTAATTCCTCAGCAACCTTTCTCGTCCCTTCCTTGAAATTCTCCACCGGAATA
TCGAATTTCGCGAATCTGAGTAATGGGTTTTCTCTAAAATCTCCAATTAATCCTGGGTTTCTCTTCAAGTCTCGTCCTTTCACTGTCCAAGCTAGAGCTGCTGCAGAAAAAACCGTTCAC
GATTTCACCGTTAAG
GACATTGATGGGAAGGATGTTGCTTTGAACAAATTCAAGGGGAAAGTTATGTTGATTGTCAATGTTGCTTCAAGATGTGGTTTGACATCATCAAATTACTCAGAG
CTTTCACATCTGTACGAGAAATACAAAACTCAAG
GATTTGAGATTCTAGCTTTTCCCTGCAATCAGTTTGGTTTCCAAGAGCCCGGGTCAAACTCCGAGATCAAACAATTCGCTTGCACC
CGGTTTAAAGCAGAGTTCCCTATATTTGATAAG
GTTGACGTGAATGGACCAAGCACAGCGCCGATCTACGAGTTCTTGAAATCAAACGCAGGAGGATTCTTGGGTGGTCTCATTAAATGG
AACTTTGAGAAGTTCTTGATTGATAAAAAGGGAAAGGTCGTTGAGAGGTACCCTCCCACCACATCCCCTTTCCAAATCGAG
AAAGACATCCAGAAGTTGCTTGCCGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACTATATCA TCTCTCGGTT TCACTATTGA ACGTGTAACA CTGGTCGAAA GAAGACGAAC ATAAACTCGT CTCCGGTAAC CAAAAATGGT TTCCATGACT ACTTCATCTT CTTCGTACGG  AACATTCTCT ACAGTCGTCA ACAGTTCTAG ACCTAATTCC TCAGCAACCT TTCTCGTCCC TTCCTTGAAA TTCTCCACCG GAATATCGAA TTTCGCGAAT CTGAGTAATG GGTTTTCTCT  AAAATCTCCA ATTAATCCTG GGTTTCTCTT CAAGTCTCGT CCTTTCACTG TCCAAGCTAG AGCTGCTGCA GAAAAAACCG TTCACGATTT CACCGTTAAG GACATTGATG GGAAGGATGT  TGCTTTGAAC AAATTCAAGG GGAAAGTTAT GTTGATTGTC AATGTTGCTT CAAGATGTGG TTTGACATCA TCAAATTACT CAGAGCTTTC ACATCTGTAC GAGAAATACA AAACTCAAGG  ATTTGAGATT CTAGCTTTTC CCTGCAATCA GTTTGGTTTC CAAGAGCCCG GGTCAAACTC CGAGATCAAA CAATTCGCTT GCACCCGGTT TAAAGCAGAG TTCCCTATAT TTGATAAGGT  TGACGTGAAT GGACCAAGCA CAGCGCCGAT CTACGAGTTC TTGAAATCAA ACGCAGGAGG ATTCTTGGGT GGTCTCATTA AATGGAACTT TGAGAAGTTC TTGATTGATA AAAAGGGAAA  GGTCGTTGAG AGGTACCCTC CCACCACATC CCCTTTCCAA ATCGAGAAAG ACATCCAGAA GTTGCTTGCC GCTTAAAAAC TTTTGCTCAT GAGTGAGCAT ATAGAGACTG ATGGTTAAAG  TAACCGTAAA TTGTGACATA AAGTTTCCGG TTATTGCTTG TATACCTTCT TACATTCTAA GTTGTACTAA TCGCTTAATA ATTTGCGTAT AATGGTAATG TTATATACAT TATATTATAA 
AAATGGTGTT ATATATACAA TAAGACA 

Retrieve as FASTA