Entry information : AtGPx02 (At2g31570 / ATGPX2 / GPX2)
Entry ID 2500
Creation 2006-06-14 (Marcia Pinheiro Margis)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtGPx02 (At2g31570 / ATGPX2 / GPX2)
Name (synonym) AtGPx02 (At2g31570 / ATGPX2 / GPX2)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Green siliques
Inflorescences
Leaves
Mixed tissues
Roots
Rosettes
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtGPx02
start..stop
S start..stop
AlyGPx02 341 8e-123 1..169 1..169
BnGPx02-2_other 331 7e-119 1..169 1..169
BnGPx02-1_other 323 8e-116 1..169 1..169
BrGPx02_other 321 9e-115 1..169 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13439731..13439775 45 N° 2 13439404..13439480 77 N° 3 13438917..13438978 62 N° 4 13438691..13438809 119
N° 5 13438336..13438503 168 N° 6 13438211..13438249 39  
complement(join(13438211..13438249,13438336..13438503,13438691..13438809,1343891 7..13438978,13439404..13439480,13439731..13439775))


exon

Literature and cross-references AtGPx02 (At2g31570 / ATGPX2 / GPX2)
Literature Rodriguez Milla M.A., Maurer A., Rodriguez Huete A., Gustafson J.P. Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways. Plant J. 36:602-615(2003).
Protein ref. UniProtKB:   O04922
DNA ref. Phytozome 11:   Chr2 (13439775..13438211)
Cluster/Prediction ref. Phytozome Gene 11:   19640561 UniGene:   At.10210
Omic ref. TAIR:   At2g31570
Protein sequence: AtGPx02 (At2g31570 / ATGPX2 / GPX2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18845.67  
PI (pH):   %s   5.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALGQASS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns), 7 cDNA and 56 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCAATCCCA AGATTACTTA AAGGTACTTT GTTATAATGG ATTGAAAAAA ATTATTCTCA AGTAGTCAAT GCTTAGAATG GTTCTTATCT TACTCTTTGT GAATGACATT CCCAGGGTAC  ACAAACACGA GAGAAAAATG AGCTGCTTAG CCGTCAATTT GGAATTGAGT ACAACTCATT ACCTGTAATC TTTCGAATGG GTTCTTCGGT TTTCCGTCTA AAGGTTAGTA TTGCCTTAAC  TTTAAATCTA TGCATAGAAA GATTATGATA CAGTGGACTG GCTGAGAAAC TTTATAAGTG CCAAACTGGT TCTGCTCTTA TCGTATCGTA TGAATCAATT AAGTTACTCA AACCTTTGGC  TGTTAACTCG TAAATGGCTA AATCCATATA CCAAACCTGA AATGTAACTA CCTGCCGAGG TTTCTTACTG TTTCTATCAA ACTCATCAAG CAGTCGTGAA GATCTTCTTC CGTTGCAGAA  CTTGATATTT GTAGAGCTGT CTGAATATTC TTTTTCAGGA AGCTGAGAAT GGAGTAGTTT CAGGGAAGAA ACTGGAAGGA GAAGTGGTCG TGGATCATTG CAACATCATC GAACGCTGTT  TCTGGGAAGA ACACCTACAC ATTCTTAGCT ACTCATAAAC AGCTGCATTT TAGTATTTTA CTTCACTTGT AAGACTAATT TATTGCAAAT TCTTAATCTC CAATTAGCAC AGCTTTACTT  CTTTTCAACA TGTGTTATAC CTTAGTTTTT CACATGTATG TCAACCATTG TTAAGATTTT AGAAAAGTTA TTGGTTTTGT ATGTTAAATA CATTTGTGGA AGACGAGAGA AGGGAGATAG  ATAGATATGT AAAACATTAA ATTCACACCA TACCTGTGCA CCGACCAACT GCTAACTTCT CTTGCGTTAC GTAAAAGTAA CTTTATCCTC TCCATTTATT TTGTTAATGT ATAATCACTA  GAGACCAGTA TTATTAATAA TTTTCTATCA TGTTGTTGAA TAGTACTAGT AATTCAAATG TCTATTAAGT CGGTCCAACT ACTTGATAAG ACCTATAGAC TAAAATTTTC AGGTCCGGTG  GTTAGATTCT GAGATATGTT TTTGTTCTCA TTCCATTTTA AATTCCGACT TTATGTACTT GTATATATTT GGTGAAAAAT TTGTATATAA CTTTTAAATT ATTCAACCGA GCAAAAGTAT  ACTTTTTTGT TTGTTTGCCA CACATTGATT GATTTATTAC TTTTAAGTAT ATCAATTTAA CAGGGAAATA TAACTGAATC TAGTAAATAT AATAACTTTC TTGATTTGGG TCTCAAGTCT  GAGAACCAAA AACCCAATGA TATTTTGATA AAATACTATT TTTTACGTGA CAACTTGCAG TAAATCAGTA TCTATAAATT CTAGATGTTT TCCTATAATT TTCTTGCTTT TTGAACAAGC  TATAATTAAG AAAAATCAGG TCAAACATTG GAAAGCATAA TTGGCAGCGA ATCCTATTAC AGATTTTTTC CATTAATCAT ATCGTTAATA TCTAAAATGA AAGTCAATTG TAGTGGTCGT  TTTGGAAAAT ATGAAAGGTG GCAATTTGAT ATGTTTTTTT TTGTAGTGAA ATTTATTTCC AATTACGTTA ATATTTAAAT AAATTCCGTG TAAATATTGA TACTCGACAC AACACGCAAA  AAAAAAAAGA AAAAAAAAAA AAGAGTTATA TATTTGAGAT TTCTTGATTT TAAATAAGGA ATTGAGTTCA TGTACCAACT AATCAATGAA AGACAGAAAT AAGAAAAATA TAAAAATGAG  AAGGGTAAGC AATCAATATG AAGTCGTGGA TGCTTACCCC ACCATTCGTC ACAAGAGATT CGTCATTTAA AGCATTCTGA TCTTATAACA TTTATCAACC ATATATATAC ACACAAAATA 
TTTGTTAACA AAAAGATTTA TATTTCTTCT CTTCTTTGTT CATAACTAAG AACTCAGAAA GAGACCAACG ACACTGCAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCACCAGAAG AAGAAGTTTC AAGAACTTTC GTTTGGTCCA AATTATGATC TTAGAATCAT CAACATTGCA AACTTATTTT CTTTGAATTC TATCATTCTT GTTTTAAATA ATTGATGTAT  TCGATGTCTT TTCATGGGAT GATATATCAT ATATTATCAT GTGACTCTCG TTCAAACAAA CCTCAAATCA TAAAAAGTTG AGTAATAAAT TCTATTGGGT CATTATTAGA CATTTGTATA  CGTAAAAAGA ACATGTGAAA GGATTTTTGC CCTATCGTAC ACGACACGTT TAAGTGTGTT CACAACTTAT GACCACAAAA AGTTTCTGAT TCTTTCCTAG CCACGGGACA AAAAGATAAG  AATCACATGT AAAAGAACAT AAAAGAAGGG TCATGTGCTT TCTTTGTTGA CATCTTGTGA TTGAAGCAAA ACCTCATCAT ATAAGCCTAA TTACCAATGA TACAAAAACA AGATGAAGAT  CATGAAAGAA CAGAAGATAT CAAAACATGA ACAGTTAGAT CAATTACCTC AGCCAAAAAC AGAGGTCTTC AAAAAAACAG TTGGAGATTG ATTTCTGTGT CTAAATCTCA TCACTGCATA  TGAGAGGACA AGAACCCTAA TTCAGATGTC ATATGTTAAG CAACCACATT GCACTCAATC ACAACAGTCA GGAGAACTGT AGACAAAGAA TTTGAAGTTT TTTTATTCAC TTGACACAAT  TAAAATCATA AAGACTTAAG ATTACTACAA CACATAACAT ACATAGAATT TTAAAGTAAA AGCCAAACCA GTTTATCCAC AGACACATTT GCAGGTCTAT TCTCAGCGAA CAATGGCAGA  GACTTCATTC TTGCAAAGAC GGTCTTTCTC TGGTTCAAAG ATGAAAATCG ATTCTAGTTC AGCTGCACAA CCGTACGGTG CAAGCAACAG TTTGTGCCCA ATATTTGAGT CTAGCTTTTA 
CATCATCTGG ATCATCACCT GAATCAAAAA TTGCAACAAT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGATGAATCTCCAAAGTCTATCTACGACTTCACCGTCAAGGTTTTTCCTCTCAACGTTTTTCTTGCTTTTATTCATAAATTATCAGGGTTTTTTTTTTCATAACTATTATGATTA
GTCTTAGATTCTTAATACACATAAACAGAAAGAGATTTTGTTTTGATCCGAAATTACGATACCGGAATTTCTAATGTTCGATCTCAGGCAAAAGAATATAGATGAACAATTTCAAGGTTT
GTTATAAAAAGAAAACATATTATGTGTGTTTATATTTTATTCATGAACATGGCAGGATATCGGAGGTAACGATGTGAGTTTGGACCAATACAAAGGCAAAACTCTTTTGGTTGTAAACGT
TGCTTCCAAATG
GTAAAAATCCCTTTTCACTGTTTTTCATTTTTTTGTTGGTTAGAATTCATTGCCTAATTGTACAAGATAGTATTTGTGATCTAAGAAAGGAAGCAACGTTTGATTTCA
CTTTTTGGATTATTATGTTCAACTTTAAGTATTGGTTGTATGGCTTGTATGCTCATTGATATCTGTAAAAAAAAGTATTTGTGATCTACCAGATTAAAAAATATAATTGCAAGGATCTTG
TGAAATTAGTACTTGTTCAATCCGGTTCAGTTTGGTTTGATTAGTACTTGTCCTTTTTTCTTAACCGCAACATAGGTTTGTTAAAATATAAACAGAGATTTCGAGTAATATTGGTCTTCG
TTTGTTCAAATTTAAGATTTTGCTTAAAGTCAATCAAATAGATGAAATCAAAACTAAACTTCCTGATTAACTTGCAGTGGTCTGACGGATGCGAACTACAAGGAACTGAATGTTCTGTAC
GAGAAATACAAGGAGCAAG
GTCTTTGATTTATATACTATAGCTAGCTCCCACAAAACTAAACCTGGTTTTAGTTAGGATTTTAATTCTTGTCACTATAACTAAATAAATGTAAAAAATGA
GAATAGGGTTGGAGATATTAGCATTCCCGTGTAATCAGTTCTTAGGACAAGAACCAGGAAACAATGAAGAGATTCAACAAACTGTCTGCACCAGGTTCAAAGCTGAATTCCCCATCTTTG
ACAAG
GTAGTTCATTTTTCTTTTTATTACACTTCTCTCTTTCATTGGTTAAATGTTTTACTAGTGACTGATCTTTACAACATTAAGGATATGTGACTTTCTGTAAGTAACTTAATGAGGA
ATGATGATTGTCTAATAGGGAAAGAAAAATAGTATATATAAATAGTTGACGGAAATGTTGACGGCAATGTAGGTGGATGTGAACGGTAAGAACACGGCACCATTATACAAGTACTTGAAA
GCAGAGAAAGGAGGTTTGCTCATTGATGCTATCAAATGGAACTTCACCAAATTCTTGGTTTCTCCTGATGGCAAGGTCTTACAGAGATATTCTCCCAGAACCTCTCCTCTTCAATTCGAG
GTACGTATACCATCCTGGTTTTCACCTAAACCGGAATCCATCCATACACAACCATCTTATTACGGTTTGTTATTCGGTTTATGCAGAAGGACATTCAAACTGCGTTGGGACAGGCCTCTT
CTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGATGAATCTCCAAAGTCTATCTACGACTTCACCGTCAAGGATATCGGAGGTAACGATGTGAGTTTGGACCAATACAAAGGCAAAACTCTTTTGGTTGTAAACGTTGCTTCCAAA
TG
TGGTCTGACGGATGCGAACTACAAGGAACTGAATGTTCTGTACGAGAAATACAAGGAGCAAGGGTTGGAGATATTAGCATTCCCGTGTAATCAGTTCTTAGGACAAGAACCAGGAAAC
AATGAAGAGATTCAACAAACTGTCTGCACCAGGTTCAAAGCTGAATTCCCCATCTTTGACAAG
GTGGATGTGAACGGTAAGAACACGGCACCATTATACAAGTACTTGAAAGCAGAGAAA
GGAGGTTTGCTCATTGATGCTATCAAATGGAACTTCACCAAATTCTTGGTTTCTCCTGATGGCAAGGTCTTACAGAGATATTCTCCCAGAACCTCTCCTCTTCAATTCGAG
AAGGACATT
CAAACTGCGTTGGGACAGGCCTCTTCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCAACCATA TATATACACA CAAAATATTT GTTAACAAAA AGATTTATAT TTCTTCTCTT CTTTGTTCAT AACTAAGAAC TCAGAAAGAG ACCAACGACA CTGCAAATGG CGGATGAATC  TCCAAAGTCT ATCTACGACT TCACCGTCAA GGATATCGGA GGTAACGATG TGAGTTTGGA CCAATACAAA GGCAAAACTC TTTTGGTTGT AAACGTTGCT TCCAAATGTG GTCTGACGGA  TGCGAACTAC AAGGAACTGA ATGTTCTGTA CGAGAAATAC AAGGAGCAAG GGTTGGAGAT ATTAGCATTC CCGTGTAATC AGTTCTTAGG ACAAGAACCA GGAAACAATG AAGAGATTCA  ACAAACTGTC TGCACCAGGT TCAAAGCTGA ATTCCCCATC TTTGACAAGG TGGATGTGAA CGGTAAGAAC ACGGCACCAT TATACAAGTA CTTGAAAGCA GAGAAAGGAG GTTTGCTCAT  TGATGCTATC AAATGGAACT TCACCAAATT CTTGGTTTCT CCTGATGGCA AGGTCTTACA GAGATATTCT CCCAGAACCT CTCCTCTTCA ATTCGAGAAG GACATTCAAA CTGCGTTGGG  ACAGGCCTCT TCTTAATCAC CAGAAGAAGA AGTTTCAAGA ACTTTCGTTT GGTCCAAATT ATGATCTTAG AATCATCAAC ATTGCAAACT TATTTTCTTT GAATTCTATC ATTCTTGTTT  TAAATAATTG ATGTATTCGA TGTCTTTTCA TGGGATGATA TATCATATAT TATCATGTGA CTCTCGTTCA AACAAACCTC AAATCATAAA AAGTTGAGTA ATAAATTCTA TTGGGTCATT 
ATTAGACATT TGT 

Retrieve as FASTA