Entry information : AtGPx03 (At2g43350 / ATGPX3 / GPX3)
Entry ID 2501
Creation 2006-06-14 (Marcia Pinheiro Margis)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtGPx03 (At2g43350 / ATGPX3 / GPX3)
Name (synonym) AtGPx03 (At2g43350 / ATGPX3 / GPX3)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Leaves
Mixed tissues
Roots
Seedlings
Seeds
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtGPx03
start..stop
S start..stop
AlyGPx03 410 5e-149 1..206 1..206
RsGPx03 303 8e-107 1..206 1..197
BnGPx03_other 300 1e-105 1..206 1..197
ThasGPx03 298 2e-104 1..206 3..198
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18010372..18010533 162 N° 2 18009924..18010000 77 N° 3 18009767..18009828 62 N° 4 18009559..18009677 119
N° 5 18009309..18009476 168 N° 6 18009195..18009227 33  
complement(join(18009195..18009227,18009309..18009476,18009559..18009677,1800976 7..18009828,18009924..18010000,18010372..18010533))


exon

Literature and cross-references AtGPx03 (At2g43350 / ATGPX3 / GPX3)
Literature Rodriguez Milla M.A., Maurer A., Rodriguez Huete A., Gustafson J.P. Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways. Plant J. 36:602-615(2003).
Protein ref. UniProtKB:   O22850
DNA ref. Phytozome 11:   Chr2 (18010533..18009195)
Cluster/Prediction ref. Phytozome Gene 11:   19642919 UniGene:   At.28611
Omic ref. ePlant:   At2g43350 TAIR:   At2g43350
Protein sequence: AtGPx03 (At2g43350 / ATGPX3 / GPX3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   206
PWM (Da):   %s   23172.04 Transmb domain:   %s   i19-36o
PI (pH):   %s   9.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRSSRWVNQRATSKIKKFILFLGVAFVFYLYRYPSSPSTVEQSSTSIYNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTGFEILAFPCNQFGSQEPGSNMEIKETVCNIFKAEFPIFDIEVNGKNTCPLYNFLKEQKGGLFGDAIKWNFAKFLVDRQGNVVDRYAPTTSPLEIEKDIVKLLASA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 6 introns), 8 cDNA and 25 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTGGCTGTAG TGAAGACTGT TCATATTGTC CTCAGTCTTC GAGATATAGC ACTGGAGTTA AGGCACAAAG ACTCATGTCT AAGGACGCTG TCATTGATGC TGCTAAGAAG GTTTGCACTT  TTCTTGTGAA TGTTTATTTT TGCTGAATGT AGAATCCTTA GCAGAATGTA TCAAGAAGAA GGGGACATGC ATTACTATGT ACCAAAACGT TGTTTTTATC AATCCGAGCT CTATCTCTAT  CCAAAAGACT CTAATTGTTT AATGAAGCAT TTTGACGATG TAATGAGCTC TTCTGATTTG AATTAACAAA TTTGATGTGT TGTTAGGCAA AAGAAGCTGG GAGCACACGT TTTTGCATGG  GTGCTGCTTG GCGAGATACA ATTGGACGGA AAACCAACTT CAGCCAGATT CTTGAATACA TCAAAGAAAT AAGGTACCTT ACTATTATGC TTTTTAAGTT GAACTTTGAA TTTCCTTGTT  TATACTACAT TATATGATCC CTTTTTCAGC TGCTTCTGAA TCTAAGCTAA CTTAAAAGAT AACCCACCGA ACCGATCATT AATGGTTCTA GAATGAACAT TTTTGCATGT CAAACTAAAG  TGAAAATTTC AAAGTGTACT TGATGTATCC GTGAGCAGAA TGAATATGAT GTTGATGATG GTGTCTGGCT GAATGTGTTT ACTAACTTTC TGGGCTCTCA CTTTAAAACA GAGGCATGGG  GATGGAAGTT TGCTGCACCT TAGGCATGAT TGAGAAACAA CAAGCACTAG AGCTAAAGAA GGCTGGCCTC ACTGCTTATA ACCACAATCT TGATACTTCA AGAGAGTACT ACCCAAACGT  CATCACTACT AGAAGTTATG ACGATCGCCT TGAAACTCTT AGCCATGTTC GTGATGCTGG AATCAACGTT TGTTCAGGTA ACTTTGATAT GAAAATAGTA TTCTTGTATG CCTCAATTCT  ATAGAACTAA AGGATTGAAA CCTGTCTTCA GCTTGGTCAT TAGACTCACA GTTTTGTAAT ATTCGTTGAT TTTGATAAAT CCATAGATAC GACATGTTCT CAAGTGTTTT CTTTTACCGA  TAAACAGGAG GAATCATAGG GCTTGGTGAG GCAGAGGAAG ACAGAATAGG TTTATTACAC ACGCTGGCAA CACTTCCTTC TCACCCTGAG AGTGTTCCCA TTAATGCTCT ACTTGCAGTG  AAAGGCACTC CTCTTGAAGA CCAGAAGGTA TATCTCCACA ATCTAAAATC ACAAATTGCA AGTCATAGCA GCTACTTAGT AGGAAATGGC TTTGAGAACC GTTTGTGTTT TTGCAGCCAG  TTGAGATATG GGAGATGATC AGGATGATTG GAACCGCACG TATTGTAATG CCAAAAGCGA TGGTGAGACT GTCTGCTGGT AGAGTCCGGT TCTCAATGTC CGAACAAGCT CTCTGTTTCC  TTGCTGGTGC AAACTCTATC TTCACCGGAG AGAAGCTTTT AACCACACCA AACAATGATT TTGACGCTGA CCAGCTCATG TTCAAGACAT TAGGCCTCAT TCCTAAACCG CCAAGTTTCT  CTGAAGATGA TTCTGAATCA GAAAACTGCG AGAAAGTTGC TTCCGCTTCT CACTAATATC ATTATCCACT TTTTTTTTTT GTTTGGAGTC GGGACACTAT AGAGCAGTCC CTTTTACTAT  GTAGCATGGT TTGACGATTT TGTGATATCA TTTTTCGTTA ATCGTTATTC GAAGATGTCT AGATTTCTCA TCTGAAAGTA AACTTATTAT TCTAGAGTGT CATGAAAATT GAAGAGAAAA  GTTGCAATTA AATCTCTCAA GGCTGAGATG GGCTTTAAAT TAGGCGTAAA CTTATCAACT AGATTTTGGC CCATGTTAAG CCCATTAAAG CTTCAAACAC TATCCAAGTC AACAAGCTTG 
TTCTGTTCTG TTCTGACTTC TGAGATCGTC TTGTTCACCA AAGAGAAGAA GACTAACTGT GTTTTTTTTT TCTTTCCTCG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACATATATGT CAAAGGTGAG TTTTCGTACG AGCTCCTAAT GATCTCACCT TCCCTCTCTG GATTTGGACA AGAAACTAAT TAATAGGTTG AAAGTTATAG AGATTAAATA AAGTGATATC  TGGCATGTGA ACATATACAT CTGTAGTTAG AACATGGACT GCAACAGTTG CCAAACTCTT AGGGGCAGTT AGGTTGTAAT AACTCCTCCA AGCTCATGGG TGAAACATAG AAAGCAACAG  AATCTTGTGA AATTGCTATT ACACTTTTAT GGCCACGAAT CAGAACTATT TTCTCTGGAA ATGCTTATGG AGACCACAAG GAATAATATA ATGTGGACTG CTTTGGTGCA GGACAGGAGA  GCAAAAAGCA TCGCATCAAA CATGTCTGAG ACTGAGAATG AAAACCACTT TCTATACTTA TTCTTTACCT TTCATGTTTA TCCAAAACCA TCCATGGAAA AGAAGATGCT TGTCTGAATC  TGTGAACCTC ATTTTCTGTA ACAAAACCCC AAAAATGCTT ATGAAACATC AATAAAGAAC AAAGTTTTAT TTATTTCTCT CTTATTAATC ATCCATTACA ACAATGTCCT AGCAAAATCT  TCTTAGATCA TTAATCTTTT TATACATACA GTGTGAGCAA AGAGCTCTAC AACAATGGTT GTTTTCAAGC AGGTCAGTCT CATAAGAGAT TTCACTCCTG CAAATTGTCT GGTTTCACCA  TCTTCTTCCT CCTCCATTGA TTCCTCAGCT TTTGGTTGAT CAAATCCAAA TCTCATCTTC AAGTACATAA CCTCACAGTA CATGCCACAG CTTGTGCCCA AAATTTCAAC CTTGCTTTAA  CATCATCAGG ATTATCACCT GTTTTCAGAA AACATAATCA GACAAACTAA AACCTGAAAA TGCAATTAAA AAAGTTTTGA AAAAATTGAG ACTCACCAGG ACTAGAGATC TTCCAGCTAG 
CAATAGGACT AACAGGAGAA TCAAGAACCG ATGATTTCTT CTCTGGCGAA GAAGAAGAAT GGTGATGATG ATCTTGATCA ATAAACTTCT GACT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTAGATCAAGCAGATGGGTCAATCAGCGAGCTACCTCTAAGATTAAAAAATTTATACTCTTTTTGGGTGTAGCCTTTGTCTTCTACCTCTACAGATACCCTTCTTCGCCATCGACG
GTGGAACAATCATCCACTTCCATCTACAACATTTCCGTTAAG
GTATAATCAGCTTAAACTAGGAACTTTAGAAGCCAATTTTTCACACTCTAGGTTGATCCGCGTCTATATTTAGTCCTG
ATTCTGAAGAATCATTCTAATTGCTGATGTTTATTTATGAAAATTTTATGTTTTAATGCGAATTTAGCTAAGATAATGAATCTAGACGAGTGCCTTTATTTTAAGGACTAGTTACTAATG
CAACTGTTTAGTGTTAGATGGGGAAATGACTTTGTTTTGTGTGTCTGTGTGTGTTTTAAGTGAATCTTTCAATGACTATATGCCCCTTAAGTTCATCTTTATAGTAACGAGTTCTACTAG
TTTATTTATCATAACTCATAACTCCGTATCAATTTCTCAAATTGAAAATGTAGGATATTGAAGGGAAAGATGTGAGTTTGAGCAAGTTTACCGGGAAAGTGCTTCTTATAGTCAATGTAG
CCTCTAAGTG
GTATGTTACTAAGTACTTAATTGTTCTTACTTATTGCATATAATGTCACATTACATTGGCGTTATATATAAAATCTTGTTGTGATGAATGAGCAGTGGTCTAACACATGG
AAACTACAAAGAAATGAACATTCTGTATGCCAAGTACAAAACTCAGG
GTGTGTCTCTTTATCTCGCTGTGCCTTTCTCAGGTTATTAACAAGTTGAAATTTTTTATAAGTATTAAAGGAA
GTATCGTTTCACGCAGGGTTTGAGATCTTAGCATTTCCTTGCAACCAATTTGGTAGTCAAGAGCCAGGCAGCAACATGGAGATCAAGGAAACCGTTTGCAATATCTTCAAAGCAGAATTC
CCAATCTTTGACAAG
GTCTCAAAGTAACTGGTCTCAATTTCCATAACACGGTGCCAAATTTTCCTAGTTGTTTACATATCTCTTTTTCCAATGCAAGATTGAAGTAAATGGAAAGAACAC
TTGTCCCCTTTACAATTTCTTAAAAGAACAAAAAGGAGGATTGTTTGGGGATGCTATTAAGTGGAATTTCGCAAAGTTTCTGGTAGACAGACAAGGAAATGTCGTTGACCGATATGCTCC
AACTACATCACCTCTTGAAATTGAG
GTTAGTAGAAGTTTCCCCTCATACATTTCTCTAATCATTAAAGGAGCTTACTCTGTAGTTTTCTCGTTCTTCTTTTCGCAGAAGGATATCGTCAA
GCTATTGGCATCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTAGATCAAGCAGATGGGTCAATCAGCGAGCTACCTCTAAGATTAAAAAATTTATACTCTTTTTGGGTGTAGCCTTTGTCTTCTACCTCTACAGATACCCTTCTTCGCCATCGACG
GTGGAACAATCATCCACTTCCATCTACAACATTTCCGTTAAG
GATATTGAAGGGAAAGATGTGAGTTTGAGCAAGTTTACCGGGAAAGTGCTTCTTATAGTCAATGTAGCCTCTAAGTGT
GGTCTAACACATGGAAACTACAAAGAAATGAACATTCTGTATGCCAAGTACAAAACTCAGG
GGTTTGAGATCTTAGCATTTCCTTGCAACCAATTTGGTAGTCAAGAGCCAGGCAGCAAC
ATGGAGATCAAGGAAACCGTTTGCAATATCTTCAAAGCAGAATTCCCAATCTTTGACAAG
ATTGAAGTAAATGGAAAGAACACTTGTCCCCTTTACAATTTCTTAAAAGAACAAAAAGGA
GGATTGTTTGGGGATGCTATTAAGTGGAATTTCGCAAAGTTTCTGGTAGACAGACAAGGAAATGTCGTTGACCGATATGCTCCAACTACATCACCTCTTGAAATTGAG
AAGGATATCGTC
AAGCTATTGGCATCTGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACTTCTGA GATCGTCTTG TTCACCAAAG AGAAGAAGAC TAACTGTGTT TTTTTTTTCT TTCCTCGATG CCTAGATCAA GCAGATGGGT CAATCAGCGA GCTACCTCTA AGATTAAAAA  ATTTATACTC TTTTTGGGTG TAGCCTTTGT CTTCTACCTC TACAGATACC CTTCTTCGCC ATCGACGGTG GAACAATCAT CCACTTCCAT CTACAACATT TCCGTTAAGG ATATTGAAGG  GAAAGATGTG AGTTTGAGCA AGTTTACCGG GAAAGTGCTT CTTATAGTCA ATGTAGCCTC TAAGTGTGGT CTAACACATG GAAACTACAA AGAAATGAAC ATTCTGTATG CCAAGTACAA  AACTCAGGGG TTTGAGATCT TAGCATTTCC TTGCAACCAA TTTGGTAGTC AAGAGCCAGG CAGCAACATG GAGATCAAGG AAACCGTTTG CAATATCTTC AAAGCAGAAT TCCCAATCTT  TGACAAGATT GAAGTAAATG GAAAGAACAC TTGTCCCCTT TACAATTTCT TAAAAGAACA AAAAGGAGGA TTGTTTGGGG ATGCTATTAA GTGGAATTTC GCAAAGTTTC TGGTAGACAG  ACAAGGAAAT GTCGTTGACC GATATGCTCC AACTACATCA CCTCTTGAAA TTGAGAAGGA TATCGTCAAG CTATTGGCAT CTGCTTGAAC ATATATGTCA AAGGACAGGA GAGCAAAAAG  CATCGCATCA AACATGTCTG AGACTGAGAA TGAAAACCAC TTTCTATACT TATTCTTTAC CTTTCATGTT TATCCAAAAC CATCCATGGA AAAGAAGATG CTTGTCTGAA TCTGTGAACC 
TCATTTTCTG TAACAAAACC CCAAAAATGC TTATGAAACA TCAATAAAGA ACAAAGTTTT ATTTA 

Retrieve as FASTA