Entry information : AtGPx06 (At4g11600 / PHGPx / GPX6 / AtGPx1 / LSC803 / ATGPX6)
Entry ID 2502
Creation 2006-06-14 (Marcia Pinheiro Margis)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtGPx06 (At4g11600 / PHGPx / GPX6 / AtGPx1 / LSC803 / ATGPX6)
Name (synonym) AtGPx06 (At4g11600 / PHGPx / GPX6 / AtGPx1 / LSC803 / ATGPX6)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Mitochondria
Tissue types Flowers
Leaves
Roots
Seedlings
Seeds
Siliques
Inducers Germination
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value AtGPx06
start..stop
S start..stop
AlyGPx06 429 2e-155 1..232 1..235
ThasGPx06-1 357 1e-126 1..232 1..242
ThasGPx06-2 348 2e-123 1..232 1..241
BnGPx06-2_other 339 1e-120 64..232 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7011094..7011330 237 N° 2 7010876..7010952 77 N° 3 7010724..7010785 62 N° 4 7010511..7010629 119
N° 5 7010154..7010321 168 N° 6 7010021..7010056 36  
complement(join(7010021..7010056,7010154..7010321,7010511..7010629,7010724..7010 785,7010876..7010952,7011094..7011330))


exon

Literature and cross-references AtGPx06 (At4g11600 / PHGPx / GPX6 / AtGPx1 / LSC803 / ATGPX6)
Literature Rodriguez Milla M.A., Maurer A., Rodriguez Huete A., Gustafson J.P. Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways. Plant J. 36:602-615(2003).
Protein ref. UniProtKB:   O48646
DNA ref. Phytozome 11:   Chr4 (7011330..7010021)
Cluster/Prediction ref. Phytozome Gene 11:   19647168 UniGene:   At.23184
Omic ref. ePlant:   At4g11600 TAIR:   At4g11600
Protein sequence: AtGPx06 (At4g11600 / PHGPx / GPX6 / AtGPx1 / LSC803 / ATGPX6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   25497.24  
PI (pH):   %s   9.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRSSIRLLYIRRTSPLLRSLSSSSSSSSSKRFDSAKPLFNSHRIISLPISTTGAKLSRSEHSMAASSEPKSLYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYKGGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDVDVNGDKAAPVYKFLKSSKGGLFGDGIKWNFAKFLVDKDGNVVDRFAPTTSPLSIEKDVKKLLGVTA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns), 7 cDNAs and 76 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATGACAGAG ACAGTTCTTT CTGATCCTTC AATGCCTCAG ATGCATATTT CTCAATATTG AAGCTCTTGG TCTCCTTCCT TTCTTCATGA GACTTTTTCC TTTGAATCTC GGGAGTGTTG  ATTGATGTCT CACTGCCGTT GGTGGTAAGG AAAGTCTTAG TTTTATTTCC TTTGGATAGA TCTCTAGTCT TAGATCTGTT TTTAATTTAA CTTGGATTTA TACTTTGTAC TTTGTTTTTG  AGTTCTTTTA GTAATGAGTT TGAGAAGTTT AGATTTAGTA TCAATGTTTT TCTTTATTTT TGAGTTTTTT TTTCATTTTC GATATGTTTT TATTCCCGAG AGATATTGTT TGCTCGCCGG  CTTAATTTTG GGAAGGATTG TTTTCCTTGC CGACATATGT GTTAAAAATA AAATAAATAC AAAAATACCC TTTAAAAAAA ATTCCAGCAA TTTTATAAAA GTCTATCGTT TAATTACGGC  AGATTTATTC TTATTCCGCA GACTTTTTTA ACTGCGACAG ATTTTCTATG GCAGACTCTT TTGGTTGACA GACTTTTTAG AAGATAGTGA TGACAGATTT ATAAATTATA GCTGATTTAA  TTTGATTGAC AGATTTTTAT TTTATTCAAC CACAAACTTT TATATAATTT TATAGACTTA TTTTTTTGTC GTTGTATTTT CACGGTAAGT GATGGCAGAT TTATGATTTT GTTAAACAAA  TCTGTCACAT TGTAACAGAT TTGTTGTCAA AAAATTAATT ACTAGAATGA CGTCTAACGA TAACCAATTT TTTTTAATGT TATGACAGAC TTGTTTTAAG TTATAACAGA TTTATGTAAT  CTTACACAAT ATCTGTCGTT TGTTGGCAGA TTTATTTTCT AAAATATGAT GTTTTGTGTT ATGACAGAGT TGTTTTATGT TGTGACAGAT AAATTTATAT TACCATAAAT CTATCGTTTG  ATGGCAGGTT TAATAAATAA GAAAATAAAT TGCTGAAATG ACCTTAAAAA TATTTTATGT TACGACAGAT TTGTAATTAG GAATTCTTAT GGTGACTGAT TTTTAGTTTT CTTGTTCCAT  AATTTTTTGT AGTAGAATAA TACTAACTGT TGTGACAGTT TTTTTTTCAT TTTAGCTTGT TATGACTGAT TTACTAAAAT TAGTTACAAT ATTTAACTCA TAAAAAATAT TAATATCGAG  ATACAACTAG GGTTTTGGTT ACAAAAACTT AGTCTCCTTA CAAAAAATAT GTGGCCTCCT TTCTTTCTTT TGTTTATCTT TTTTTTTCCT TTGGAAATCT CTTTTCAGTT TTTGGAGTAG  TGGAAGCAAT ATATTGTTTC ATCTCTTTTC CTCGTATGTG TGTGGGTTAA AAAAATATGA AACCTATAAA CTCAGAATTT TGAGCGATAT TTTTTTAAAT TTTTCCTTAC TTATTTGTTT  TTATTTTATT TTTAATTTCA TTTTACATTA TTTTTTTAAT ATCAGATGTT AAAAATTTCA AAAAAAATAC AGACCAAGGT TTTTTGGTCA TTATACACCA AAATTGTGTC AATCTAATTC  TCTAATCAAA TAGAGAGTCA TTCTAGTTAT TATTGGCTAT ATTTGTGTCA ATCTAGGTAA TTTTGACAAA AAAAAAAAAG AAAAAAAAAA AAAGAGAACT CCAAATCCAG ATTGTGAAGC  ATATTTCAAT TTCGCACTTA TTCGATCATA AAAGAATTTA CATAATTCGT TCATAAAATG TATGGGCTAA ATTTAGGCCC AGTATGAGAA AAAATCCAAA AGGCAGTAGT AACGTTCACA  TTATGCCGCC ACAAAAAACG CAACTGATGA CGTAAGCACA CCGAGTGTTC CGACGATTCT CCAACGTGGC TTTCTCTTAA ACATCCACGT GTCTATTCCA TTCTCCAACC ACTGAACACG 
GATCAAGAAA CTAAAATGAT ATTTTGACTC CAACCAAAAT AAATATCTAA TTTTGTGAGA AAAGAATCTT CTTTTGCAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAAGGCAAG ATTGCATAAT TAGACAAATA AAAGCTCATT AGTATTGTAT TACCAATACT GTGTAGTAAG CTGAGTTCGT GAGTGTGTGC CTTTGGGACC GCGTACAATT ATAATCCGTT  TTTTAGCGGC CAAACTATGT AATAATCGTA GATCTAAATA TCAGATTTCC CGTTACCTTA CAATTTGGAT CAGTCTTTGT TACCAAAGCA TGAAACTGTG TCTCCTACAA CAACCGAACA  GTCTCTACAT AATCCGGAAA AACCATTGCT TTTGTTTCCC GATGCTTGAA GTCATAGCCT CCGTGTACTT CAACCTTGGT TTTTCTTAAA CTTTTCGTGT CGGGATTGTA ATAGATAACA  TAAAAGCTAT TAGAATAGAA CCGTGGTGCC AAAATAAACT CACCTGTATG AGTAGTGCCT GTGATAAATA AATCACAAAA TAACCACCTC CTAACACCTT TGATACTGAA ACTTTTCTTC  AACCATCCAT GAATTTCGGC TTGCTGATCC AAAACCCACA CTTCAATACC AATAAATAAA GTTTTAGTGG CTAAGGCTAC TTTCCCCTTG TACCTCATCA AAGTGAAACC ATGTAGAAAT  GCAGCTGGAA AGTCCGCGGG TAAACTAGTA AAAAGATCCA ACTTTTCAGA CCCCAAATCG AATCTCATTA AGCTCAGCTG TGACAAATCT TCGCCCGTAA AAGCAACATA ATATAAAACA  CCATCTATGC ACACACTGTT CAGCACAGGA CCGTGAGGAG TTGTATAATC AATCATTCTC CATGGTTTCT TTTTAACTCC CAATGGGAAT ACTTGATGTT GAGATGATAG TTGTAATATT  CGAGTTCGAC CGTCATGACG TTGCATTTTT TCCTTCATGC ACAATACCAA TAGTTTGTAT TCATCATTAA CCGGATCATA CCCCAAAAAA CATTGCGCAA CCTTACTATT GGTTTGGACT 
CTCCCTAAAA CTGTGGATTT ACCGGTGCTA GGGTTAGTTA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCGCTCCTCAATTCGACTTCTCTATATAAGAAGAACCAGTCCTCTGCTTCGAAGTTTATCATCATCATCATCATCATCATCATCAAAACGATTCGATTCTGCGAAACCACTTTTC
AATTCTCATCGGATTATTTCTCTTCCAATTTCTACAACGGGAGCTAAACTATCTAGATCGGAGCATTCAATGGCTGCTTCTTCCGAACCCAAATCTCTTTACGATTTCACCGTCAAG
GTT
CGATTCAAATGATCCTTTTCTTTGATTCTCTTGCGATTTGATTACGTTTGATTCTCTGAGTTTAATCTTTGACTATTTCGGAAATTTGAATTTGTTGATCGGATTTGGGATTTGGTATTG
ATTGATTTATTGGATCAGGATGCTAAGGGAAACGATGTTGATCTAAGCATCTACAAAGGGAAGGTTCTTTTGATTGTGAACGTTGCTTCTCAATGGTAAGATTTCGATTTTGTAACGTTT
AGATGTGATCATAGATTCATTGGTTTTAGTGACTTAGTTTCTTTGGTGATTTGATTCTTCTGCAGTGGCTTGACTAATTCGAATTATACTGAGCTTGCGCAGCTGTATGAGAAGTACAAA
GGCCATG
GTATATAATTTTGTTACTAGTTGTTTCATGTTTGTTTGTGATCATGGTTTATCATCGTGTTTGTTATTGTTGATGGTTGCAATTTTTGATTTAGGTTTCGAGATTCTTGCGTT
TCCGTGTAACCAGTTTGGGAATCAAGAGCCTGGTACTAATGAAGAGATTGTTCAGTTTGCTTGTACTCGTTTCAAGGCTGAGTACCCGATTTTCGACAAG
GTAACAACTTTTCTTGACAC
ACGAGACGAAGATATGTGAGAATGTTGCTAGCTCTTAGAGCATCACTGAATAATTTTTGGAATTGGATGATGTAGTCTGAGTATCAGTGACTCATTTTCAGATAATGTTTCGTTTTGAGT
ATAAGTTCTCTACTTGGAGTTGATTCTACCTTTGCACTATGTAATGCAGGTTGATGTTAACGGTGACAAAGCTGCCCCAGTCTACAAGTTTCTGAAATCAAGCAAAGGCGGGCTCTTTGG
AGACGGCATTAAGTGGAACTTCGCAAAGTTCTTGGTTGACAAAGATGGAAATGTTGTCGATCGTTTCGCACCAACTACCTCACCTCTCAGCATTGAG
GTAATGTCTCTATCACATGTAAT
CATCAAAAGCTTGAGTTTTGTTTAGAGCCACAAAGTTTCTAATTGCTTGTCAAATCGTTGTTTCGCAATTGCAGAAGGATGTGAAGAAGTTGTTGGGAGTTACTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCGCTCCTCAATTCGACTTCTCTATATAAGAAGAACCAGTCCTCTGCTTCGAAGTTTATCATCATCATCATCATCATCATCATCAAAACGATTCGATTCTGCGAAACCACTTTTC
AATTCTCATCGGATTATTTCTCTTCCAATTTCTACAACGGGAGCTAAACTATCTAGATCGGAGCATTCAATGGCTGCTTCTTCCGAACCCAAATCTCTTTACGATTTCACCGTCAAG
GAT
GCTAAGGGAAACGATGTTGATCTAAGCATCTACAAAGGGAAGGTTCTTTTGATTGTGAACGTTGCTTCTCAATG
TGGCTTGACTAATTCGAATTATACTGAGCTTGCGCAGCTGTATGAG
AAGTACAAAGGCCATG
GTTTCGAGATTCTTGCGTTTCCGTGTAACCAGTTTGGGAATCAAGAGCCTGGTACTAATGAAGAGATTGTTCAGTTTGCTTGTACTCGTTTCAAGGCTGAGTAC
CCGATTTTCGACAAG
GTTGATGTTAACGGTGACAAAGCTGCCCCAGTCTACAAGTTTCTGAAATCAAGCAAAGGCGGGCTCTTTGGAGACGGCATTAAGTGGAACTTCGCAAAGTTCTTG
GTTGACAAAGATGGAAATGTTGTCGATCGTTTCGCACCAACTACCTCACCTCTCAGCATTGAG
AAGGATGTGAAGAAGTTGTTGGGAGTTACTGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAAATAAAT ATCTAATTTT GTGAGAAAAG AATCTTCTTT TGCAAATGCT TCGCTCCTCA ATTCGACTTC TCTATATAAG AAGAACCAGT CCTCTGCTTC GAAGTTTATC ATCATCATCA  TCATCATCAT CATCAAAACG ATTCGATTCT GCGAAACCAC TTTTCAATTC TCATCGGATT ATTTCTCTTC CAATTTCTAC AACGGGAGCT AAACTATCTA GATCGGAGCA TTCAATGGCT  GCTTCTTCCG AACCCAAATC TCTTTACGAT TTCACCGTCA AGGATGCTAA GGGAAACGAT GTTGATCTAA GCATCTACAA AGGGAAGGTT CTTTTGATTG TGAACGTTGC TTCTCAATGT  GGCTTGACTA ATTCGAATTA TACTGAGCTT GCGCAGCTGT ATGAGAAGTA CAAAGGCCAT GGTTTCGAGA TTCTTGCGTT TCCGTGTAAC CAGTTTGGGA ATCAAGAGCC TGGTACTAAT  GAAGAGATTG TTCAGTTTGC TTGTACTCGT TTCAAGGCTG AGTACCCGAT TTTCGACAAG GTTGATGTTA ACGGTGACAA AGCTGCCCCA GTCTACAAGT TTCTGAAATC AAGCAAAGGC  GGGCTCTTTG GAGACGGCAT TAAGTGGAAC TTCGCAAAGT TCTTGGTTGA CAAAGATGGA AATGTTGTCG ATCGTTTCGC ACCAACTACC TCACCTCTCA GCATTGAGAA GGATGTGAAG  AAGTTGTTGG GAGTTACTGC TTAAGCAAGG CAAGATTGCA TAATTAGACA AATAAAAGCT CATTAGTATT GTATTACCAA TACTGTGTAG TAAGCTGAGT TCGTGAGTGT GTGCCTTTGG  GACCGCGTAC AATTATAATC CGTTTTTTAG CGGCCAAACT ATGTAATAAT CGTAGATCTA AATATCAGAT TTCCCGTTAC CTTACAATTT GGATCAGTCT TTGTTACCAA AGCATGAAAC 
TGTGTCTCCT ACAACAACCG AACAGTCTCT ACATAA 

Retrieve as FASTA