Entry information : AtGPx08 (At1g63460 / ATGPX8 / GPX8)
Entry ID 2503
Creation 2006-06-14 (Marcia Pinheiro Margis)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtGPx08 (At1g63460 / ATGPX8 / GPX8)
Name (synonym) AtGPx08 (At1g63460 / ATGPX8 / GPX8)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Roots
Siliques
Inducers Auxin treatment
UV irradiation
Repressor N/D
Best BLASTp hits
Perox score E-value AtGPx08
start..stop
S start..stop
AlyGPx08 330 2e-118 1..167 1..167
BnGPx08_other 318 6e-114 1..166 1..166
ThasGPx08 291 5e-103 2..167 6..171
NtGPx08-1A 287 2e-101 2..166 5..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23535118..23535162 45 N° 2 23535544..23535620 77 N° 3 23535709..23535770 62 N° 4 23535842..23535960 119
N° 5 23536051..23536218 168 N° 6 23536294..23536326 33  
join(23535118..23535162,23535544..23535620,23535709..23535770,23535842..23535960 ,23536051..23536218,23536294..23536326)


exon

Literature and cross-references AtGPx08 (At1g63460 / ATGPX8 / GPX8)
Literature Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.A. Full-length cDNA from Arabidopsis thaliana. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases.
Protein ref. UniProtKB:   Q8LBU2
DNA ref. Phytozome 11:   Chr1 (23535118..23536326)
Cluster/Prediction ref. Phytozome Gene 11:   19653703 UniGene:   At.15002
Omic ref. ePlant:   At1g63460 TAIR:   At1g63460
Protein sequence: AtGPx08 (At1g63460 / ATGPX8 / GPX8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18968.52  
PI (pH):   %s   4.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATKEPESVYELSIEDAKGNNLALSQYKDKVLLIVNVASKCGMTNSNYTELNELYNRYKDGLEILAFPCNQFGDEEPGTNDQITDFVCTRFKSEFPIFNIEVNGENASPLYKFLKKGKWGIFGDDIQWNFAKFLVDKNGQAVQRYYPTTSPLTLEHDIKNLLNIS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo1, 4 introns), 8 cDNAs and 8 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAAACC CATCCATGAA AAGAATCTTG ATTCCGTTCT TGATCAAGAT TCTTTACCCA AAAACGAGAT TGATCAAGAT TTCATCATTG ATTGGGATCC AGAAACTGGC GAAGAACGAT  ACCGATATTT CAAAGCGAAG ACCGAAGACG AGGAGACCGG TCTAAAATCT ACGGAAGAGT ATATTCAAAT ACAGAGAACT TGGTTATCGA TGGGAAACAA CCGCAAAAAG CCGGGATCTT  GCGAAGGAAA AGGTGTATAC GTTTACGATT TACCATCTAA ATTCAACAAA GATTTGTTGA GGGAATGCTC CGATATGGTT CCATGGGCTG ATTTTTGCAA CTACTTCAAG AACGATGCGT  TTGGTGAACT GATGGAGAGT ATGGGTAAAG GCTGGTTCAG AACGCATCAG TATTCACTTG AGCCGATATT TCACTCTAGA ATTTTGAAGC ATCCATGTAG GGTTCATAAC GAGACTCAAG  CGAAGCTCTT CTATGTGCCT TTCTATGGCG GTATGGATGT TTTGAGATGG CATTTCAAGA ACGTTTCAAG CGATGTGAAA GATGTTTTGC CGATTGAGAT TGTTAAATGG CTCGGATCGA  AGAAATCATG GAGGAAAAAC TCCGGAAAAG ATCATGTTTT TGTTCTCGGA AAGATCTCTT GGGATTTTAG GAGGGTTGAT AAGTATTCTT GGGGCTCAAG CTTACTTGAG ATGCAAGAAA  TGAAAAACCC TACAAAGCTT CTCATCGAAC GTAATCCATG GGAAGTCAAC GACATCGCGA TACCTCATCC CACATACTTC CACCCGAAAA CTGACACCGA TATCGCCATA TGGCAAAACA  AAATACTTGG GAAACCTCGT CGGAGCCTAA TTAGCTTCGC TGGTGCAGCA AGACCCGGTA ACCCTGAGAG CATCCGGTCA ATATTGATTG ACCAATGCAG ATCGTCTCCA AACCAATGCC  GGTTTTTGAA TTGTACCGAT GGAGGCTGCG ATAAATCGGA ATCGGTTATC GAGCTTTTCC GAGATTCGGA GTTCTGCCTT CAACCGCCTG GAGACAGTCC AACAAGGAAA TCGATTTTCG  ATTCCCTCAT ATTAGGTTGT ATTCCGGTGA TATTTGATCC GTACAGCGCG TATTACCAGT ACACGTGGCA TTTACCGGAG GATCACCGGA GATATTCGGT GTATATAAAC AAAGAAGATG  TGAAGTTGAA GAGAGTGAAT GTGATTGAGA AGTTAATGTC AAAGACTCTA AGGGAAAGAG AGGACATGAG GAGTTACATT GTTCATGAGC TTTTGCCTGG TTTGGTCTAT GGAGATTCTA  ATGCTAAGTT TGAGAGATTT CGAGATGCTT TCGATATTAC TATGGATAGT TTATTCAAGA AGATTGCAAA AACTGTATAA CTTTCGTTTT TCGTTTGATT TTAATTGTCA AATTTTCAAA  TGTAGTTCGT TTATTTGAAT ATTTTTAAAA ATCTCAAAAG ATGATTGCCA AAATGTTTAG AAATGCCTTA TTTGTATAAG GTGGTGCAGT GGTGGTGCCA TGTGACTTAG GATAAATTAT  AAAATAGCAT ATCTAGAGAA AAGGCCTTAT GATTGTATAG GTTTCTAGTT TGACGTACGT TGAAAAAAAT CAGTAATAAA ATATAGCAAA TTGTTTTCAT GATATGATTT TTATTCTTTA  ATTAATTTTA CTATAAAGAA ATTTGCTAAA ATTTTATAAA CGCTTATGTG AGTGAATATG TTGATAAATG ATTATTTTGA TGAGTACTTA AAGCTATCAT CATTTTATAG TTTTTGGAGG  TTTTGCCAAA AACTAAAGGA TTCTGAAAAT ATATCAAAAG TGGCCCAATA GAAGCCCATT AAGACCAGTT AAAACAGAGA AACGACTCTA TATCGAACGT CACGCGCATT ACTCGCGCGT 
GTGACCAAGT CCCTTTCTCT TGCTTCAGCT TCTTTCTTTC CTTCCTCGTT GACTGCTTCT TCTGCATTTC CCAGTGAGAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGC TTTGTTGCTG AATCGTATTG TATTTGATTA TGAACCTCTC TCATTCAATA AAGAGCCATG ACATTGACTT GGATTGATTA GTTCTGTTTG AGAGCCAAAT CGGTTATTTA  GATAAACCAG CATTATTATC TCAGGCTGAT CAACTTGGAT AGATTACTTC ATTTCTAAAA CCAAACACTC AAAACCAAAA CCGAATTGAA CACAGATATT GAAGAAACCA AAGGAAGCTT  TAATGAGTGA TATAAAAGAG TTACAATCTC GTTGAGTAGC CTGAAAGTGG GGTGGTTCTG TTACATTGAG AATGTTACAA TAAGGAACTG AGAGTTCTGG TCTCAATCCT GAAATGTCTG  GTTTTAACAT TCCCAGAGAG AAATCTACAA CAACAAAGAT ATGTACAGCA CTCACATAAT GTATGCTGCT GCTGCTGCTT CCAAGACTAA AGGGTAGTAG TCGGAGTAAA TAGGAAGAAA  GACTAATAAT GTTTTTGTTT TGAATCACCC GCGAGTCAAG TCAATATCAG TGAGTGGGTT TCTGCTAGAG TCAAGTGATC TGCCTGAGCC TGAGCCTGAA ACGGGCCATC CGCTCATTCC  CTGAGCTGGG AAGTTCTGTG GCGTATGCTG ACCCGTCGAT GCTGCAGCTT CTGGTGCACT ACCAGGTGTG GTCTCCATTT CGCTATTGGT CGGCTCTTGC TTAGGTTTTA TTTCTTGTTT  GATGGTCTTG TTATTGTTAT TATTAGACTT TGCACTTGCT CCGTACACGA AACTACAAGC CACCACCTTC AAAATAACAA CCAACAAAAA AATTTAGTTT AAGAGTCACA TTACATATAA  ACAAATCCAA ACAAAATTTC TCAAACCGTA CCAGAACCGT ATTTTGAACT TTTGTATTCC AGGTAGCACA AATGTTATAC CAAACAATTA CAACCAAAAC AAAACTTAAT GGAGCCAAAC 
CAATTTTGAA ATACCTGAAC GAGGCTGGCT GCGATAAGCA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGAAGGAACCAGAATCTGTTTACGAGTTAAGCATCGAGGTGAATACATTTCTCTAACTTGAGTCATCGATTCAATAACTCTCTCTGTCTCTGATAACTTGAATGTGAGATCTT
TTGTTAAAAGGAAGCACCTTTGATATAAGGGTTCTAAGAATGTGAAGAGTTTTTACTTTAAGGTGTCTTGTAGGCTTTTCCGGATGAAAAGGAATGTCAAATTTTTATATTGTCTGAAGG
AACGATTTGTCTTCTGTTGTATCCCGATGTTTAGTTTAGGATTGCTTTTCTCAGTAGAATCAATCAGATCATGATGGATCATGTTTCTTTCTTCTGTTGATTGGTCTCTCACAGATTGTT
TTCTATGATCTTTGATTGATTTCTTGTGTTGGCCTCTGAGTCTTTATCTTGTTCTTCCTGTAACAGGATGCAAAAGGGAACAACTTAGCACTCAGTCAATACAAAGACAAAGTTCTTTTA
ATTGTCAATGTTGCTTCCAAATG
GTTAGTTTATTAGACATTCTATTAAGCTTCTTTCGTTTGTAACTTTCTCGTCTTGTCTTGTTTATTATATACTCTATGATGGTCTCAGTGGGATGAC
AAACTCAAACTACACTGAATTGAATGAGCTTTACAACAGGTATAAAGATAAAG
GTAAAGTAGTGATTTCAACAAATTTCTAAGTCCACGTTATTAGCTTCCTCATTGATGTTGTTCTGTT
GCAGGTCTGGAGATTCTAGCATTTCCTTGTAACCAGTTTGGTGACGAGGAACCGGGAACTAATGACCAAATTACTGACTTTGTTTGTACTCGCTTCAAATCTGAATTCCCCATTTTCAAC
AAG
GTACTATAGTTCACTCGATGAGTTCACTACAATTCTCTATGATTGTCCTGAAGTTCTTAAAACATTCGTATATGTCCAATTTTGTATTAGATTGAAGTAAACGGAGAGAATGCTTCT
CCTCTGTATAAGTTCCTGAAGAAAGGCAAATGGGGAATCTTCGGCGATGACATTCAATGGAACTTTGCTAAGTTTCTTGTTGACAAAAACGGTCAAGCTGTACAACGTTATTATCCAACT
ACTTCCCCTCTTACACTTGAG
GTAAAGCAACTATCTCTCATTCACTCTCTCTCAGACACTATCTCTGCTAACTTTCTTGTCTCAATTTTTCTGCAGCATGACATAAAGAATCTTCTGAAT
ATCTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGAAGGAACCAGAATCTGTTTACGAGTTAAGCATCGAGGATGCAAAAGGGAACAACTTAGCACTCAGTCAATACAAAGACAAAGTTCTTTTAATTGTCAATGTTGCTTCCAAA
TG
TGGGATGACAAACTCAAACTACACTGAATTGAATGAGCTTTACAACAGGTATAAAGATAAAGGTCTGGAGATTCTAGCATTTCCTTGTAACCAGTTTGGTGACGAGGAACCGGGAACT
AATGACCAAATTACTGACTTTGTTTGTACTCGCTTCAAATCTGAATTCCCCATTTTCAACAAG
ATTGAAGTAAACGGAGAGAATGCTTCTCCTCTGTATAAGTTCCTGAAGAAAGGCAAA
TGGGGAATCTTCGGCGATGACATTCAATGGAACTTTGCTAAGTTTCTTGTTGACAAAAACGGTCAAGCTGTACAACGTTATTATCCAACTACTTCCCCTCTTACACTTGAG
CATGACATA
AAGAATCTTCTGAATATCTCCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCACGCGCA TTACTCGCGC GTGTGACCAA GTCCCTTTCT CTTGCTTCAG CTTCTTTCTT TCCTTCCTCG TTGACTGCTT CTTCTGCATT TCCCAGTGAG AAATGGCGAC GAAGGAACCA  GAATCTGTTT ACGAGTTAAG CATCGAGGAT GCAAAAGGGA ACAACTTAGC ACTCAGTCAA TACAAAGACA AAGTTCTTTT AATTGTCAAT GTTGCTTCCA AATGTGGGAT GACAAACTCA  AACTACACTG AATTGAATGA GCTTTACAAC AGGTATAAAG ATAAAGGTCT GGAGATTCTA GCATTTCCTT GTAACCAGTT TGGTGACGAG GAACCGGGAA CTAATGACCA AATTACTGAC  TTTGTTTGTA CTCGCTTCAA ATCTGAATTC CCCATTTTCA ACAAGATTGA AGTAAACGGA GAGAATGCTT CTCCTCTGTA TAAGTTCCTG AAGAAAGGCA AATGGGGAAT CTTCGGCGAT  GACATTCAAT GGAACTTTGC TAAGTTTCTT GTTGACAAAA ACGGTCAAGC TGTACAACGT TATTATCCAA CTACTTCCCC TCTTACACTT GAGCATGACA TAAAGAATCT TCTGAATATC  TCCTGAATGA TGAAGCTTTG TTGCTGAATC GTATTGTATT TGATTATGAA CCTCTCTCAT TCAATAAAGA GCCATGACAT TGACTTGGAT TGATTAGTTC TGTTTGAGAG CCAAATCGGT 
TATTTAGATA AACCAGCATT ATTATCT 

Retrieve as FASTA