Entry information : BnaCcP01
Entry ID 2510
Creation 2005-12-28 (Nenad Bakalovic)
Last sequence changes 2012-01-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-04 (Christophe Dunand)
Peroxidase information: BnaCcP01
Name BnaCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP011]
Taxonomy Eukaryota Bigelowiella
Organism Bigelowiella natans    [TaxId: 227086 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BnaCcP01
start..stop
S start..stop
EUgAPx-CcP03 299 9e-103 33..288 3..247
EgraAPx-CcP01 298 3e-97 24..288 130..384
EgraAPx-CcP01 283 1e-91 30..292 393..645
CspCcP03 270 2e-90 26..288 52..308
EhuxAPx-CcP04 268 4e-90 26..290 2..257
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 328093..328258 166 N° 2 327746..328007 262 N° 3 327537..327615 79 N° 4 327345..327446 102
N° 5 326940..327149 210 N° 6 326776..326871 96  
complement(join(326776..326871,326940..327149,327345..327446,327537..327615,3277 46..328007,328093..328258))


exon

Literature and cross-references BnaCcP01
Literature Keeling,P.J. PEPdbPub (http://amoebidia.bcm.umontreal.ca/public/pepdb/agrm.php). Bigelowiella natans
DNA ref. JGI genome:   scaffold_38 (328258..326776)
EST ref. GenBank:   DR039603.1 [3' end]
Cluster/Prediction ref. JGI gene:   54605
Protein sequence: BnaCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   305 (282)
PWM (Da):   %s   32952.47 (30607.2)  
PI (pH):   %s   6.13 (6.29) Peptide Signal:   %s   cut: 23 range:23-304
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSALLSSIALVLVLCTAWTSAAQSDYTALSEDIRELIREKTCGPILVRLSWHDAGTFDSKSGTGGPRGAMRFSAGESTHGANNGLDIARSLLEPLKKKYSSVTYADLWSLAAIVAVEEMGGPKISWRPGRTDATSAKDSVEEGRLPDAQLGCPHLRDVFHRMALTDQIVALSGAHTIGAMHADRSGHEGPWTDQPQHFDNQYFKDLVGKEWVKTDASELGGAKGNAVYVAKGSPIKSGTPIMLPTDVAMLEDSKMRVWVDLYAADETRFFQDFSSAFTKLQELGVPAFHGISNPHSHVKTEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCGCACTTCTTTCCTCAATCGCCCTCGTCCTCGTCCTCTGCACAGCCTGGACAAGCGCAGCCCAATCCGACTACACGGCCCTTTCTGAAGATATCCGAGAACTCATACGCGAG
AAAACTTGCGGCCCGATTCTCGTTCGCCTCAGTTGGCACGATGCAG
GTCAGCAAGATTCATACCTGCCTAAACTTCGAGTGGAATTTCAGAACCTTGTATTCTAGCATCATTGCATCGGA
TTTCATTGCAGGCACCTTCGATTCTAAAAGCGGTACCGGAGGTCCTCGGGGTGCGATGAGGTTTTCTGCAGGCGAATCTACGCATGGTGCTAACAACGGACTCGACATCGCACGTTCCTT
GTTGGAGCCCTTAAAAAAGAAGTACTCGAGTGTTACTTACGCAGACCTCTGGAGCCTCGCTGCGATTGTTGCTGTAGAGGAAATGGGGGGACCAAAAATCTCATGGAGACCAGGGCGAAC
CGATGCGACTTCTGCTAAGGATAGTGTTGAGGA
GTACGAAAAATCACGCTAGTTATCGCACCACCCCCCTACACAAATTTAAGGAAAACATGGATTTTCACGATACAAGCATACTCATTG
ATCGATTTGGAACGTTAACCAACTTTGAATTTGCGTTGTAAAGGGGTCGATTGCCGGATGCCCAGCTTGGATGTCCGCATCTCCGAGACGTCTTCCATCGCATGGCACTTACGGATCAAG
AA
GTAAGAAGACTGCGTAATGATATGAAGACGAAGAGATATGCGATCACTGTGAGTGATAAAAATTCTCATATCTATCGACATCTTGAACAGATTGTCGCACTGAGCGGAGCGCACACTA
TCGGAGCTATGCATGCTGATAGGAGCGGACACGAGGGACCATGGACCGATCAACCGCAACACTTTGACAACCAG
GTCGTTATTATCTATCCTCCCTCACAAGTAAATCGAGAAGAAGAAG
AAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGTGGAGGAGGAGGAATACAGCGTATGCTCAAGGATGTATTAGGAATTGCCAGAGCTTGTTCGAGTAATAATTA
ACATGTCATTCGCTACCTGCGTATATTAGTATTTTAAGGATCTGGTCGGAAAGGAGTGGGTGAAGACGGATGCATCTGAACTTGGAGGGGCCAAGGGAAATGCAGTGTATGTAGCAAAAG
GTTCTCCAATCAAATCGGGAACGCCTATTATGCTACCAACCGATGTGGCCATGCTCGAAGATTCCAAGATGCGCGTATGGGTGGATTTATATGCTGCAGATGAAACGCGATTTTTCCAG
G
TATTTCCCGATAATAAATACAAGAAGATTGTGACCTCTAGGTTGATGACGAGCTGTCATTTTTTTAGGATTTTTCATCGGCATTTACCAAGCTGCAAGAACTGGGAGTCCCTGCATTCCA
TGGAATCTCGAACCCACATTCTCATGTGAAAACAGAGCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCGCACTTCTTTCCTCAATCGCCCTCGTCCTCGTCCTCTGCACAGCCTGGACAAGCGCAGCCCAATCCGACTACACGGCCCTTTCTGAAGATATCCGAGAACTCATACGCGAG
AAAACTTGCGGCCCGATTCTCGTTCGCCTCAGTTGGCACGATGCAG
GCACCTTCGATTCTAAAAGCGGTACCGGAGGTCCTCGGGGTGCGATGAGGTTTTCTGCAGGCGAATCTACGCAT
GGTGCTAACAACGGACTCGACATCGCACGTTCCTTGTTGGAGCCCTTAAAAAAGAAGTACTCGAGTGTTACTTACGCAGACCTCTGGAGCCTCGCTGCGATTGTTGCTGTAGAGGAAATG
GGGGGACCAAAAATCTCATGGAGACCAGGGCGAACCGATGCGACTTCTGCTAAGGATAGTGTTGAGGA
GGGTCGATTGCCGGATGCCCAGCTTGGATGTCCGCATCTCCGAGACGTCTTC
CATCGCATGGCACTTACGGATCAAGAA
ATTGTCGCACTGAGCGGAGCGCACACTATCGGAGCTATGCATGCTGATAGGAGCGGACACGAGGGACCATGGACCGATCAACCGCAACACTTT
GACAACCAG
TATTTTAAGGATCTGGTCGGAAAGGAGTGGGTGAAGACGGATGCATCTGAACTTGGAGGGGCCAAGGGAAATGCAGTGTATGTAGCAAAAGGTTCTCCAATCAAATCGGGA
ACGCCTATTATGCTACCAACCGATGTGGCCATGCTCGAAGATTCCAAGATGCGCGTATGGGTGGATTTATATGCTGCAGATGAAACGCGATTTTTCCAG
GATTTTTCATCGGCATTTACC
AAGCTGCAAGAACTGGGAGTCCCTGCATTCCATGGAATCTCGAACCCACATTCTCATGTGAAAACAGAGCTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTTCCGAAA ATACGATACA GCATCGCAAA ATGACTTCCG CACTTCTTTC CTCAATCGCC CTCGTCCTCG TCCTCTGCAC AGCCTGGACA AGCGCAGCCC AATCCGACTA CACGGCCCTT  TCTGAAGATA TCCGAGAACT CATACGCGAG AAAACTTGCG GCCCGATTCT CGTTCGCCTC AGTTGGCACG ATGCAGGCAC CTTCGATTCT AAAAGCGGTA CCGGAGGTCC TCGGGGTGCG  ATGAGGTTTT CTGCAGGCGA ATCTACGCAT GGTGCTAACA ACGGACTCGA CATCGCACGT TCCTTGTTGG AGCCCTTAAA AAAGAAGTAC TCGAGTGTTA CTTACGCAGA CCTCTGGAGC  CTCGCTGCGA TTGTTGCTGT AGAGGAAATG GGGGGACCAA AAATCTCATG GAGACCAGGG CGAACCGATG CGACTTCTGC TAAGGATAGT GTTGAGGAGG GTCGATTGCC GGATGCCCAG  CTTGGATGTC CGCATCTCCG AGACGTCTTC CATCGCATGG CACTTACGGA TCAAGAAATT GTCGCACTGA GCGGAGCGCA CACTATCGGA GCTATGCATG CTGATAGGAG CGGACACGAG  GGACCATGGA CCGATCAACC GCAACACTTT GACAACCAGT ATTTTAAGGA TCTGGTCGGA AAGGAGTGGG TGAAGACGGA TGCATCTGAA CTTGGAGGGG CCAAGGGAAA TGCAGTGTAT  GTAGCAAAAG GTTCTCCAAT CAAATCGGGA ACGCCTATTA TGCTACCAAC CGATGTGGCC ATGCTCGAAG ATTCCAAGAT GCGCGTATGG GTGGATTTAT ATGCTGCAGA TGAAACGCGA  TTTTTCCAGG ATTTTTCATC GGCATTTACC AAGCTGCAAG AACTGGGAGT CCCTGCATTC CATGGAATCT CGAACCCACA TTCTCATGTG AAAACAGAGC TTTAGAACGA AATTTGGGGG  ATTTGGTGCC GCTATGTACG ATTCATCATT GAGTAGAATT CGCGTTAGAA CTTCTGCTAA TGCGTATGTA CTTCACAGTC TCTTCACGTC TAGACATCGA TTACATAGTG ACGCGTCCAA  TGTTCATTCT GCCACTCTTT CGTTGTTTCG AAGTAGAACG ACATGAAGTC TCTGTTGTAA TGCAAGCTAT TCTAGGCTTC GAATCAGTAC TTAACACTGG CATTACTCAC GGAAAACGCT 
TTTTCCGGCG TCTTG 

Retrieve as FASTA