Entry information : BnaCcP02
Entry ID 2511
Creation 2005-11-11 (Nenad Bakalovic)
Last sequence changes 2012-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-04 (Christophe Dunand)
Peroxidase information: BnaCcP02
Name BnaCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP006]
Taxonomy Eukaryota Bigelowiella
Organism Bigelowiella natans    [TaxId: 227086 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BnaCcP02
start..stop
S start..stop
PtrCcP02 321 1e-109 19..267 16..263
CsubCcP01 319 2e-109 8..267 84..346
GprCcP03 314 1e-108 9..272 2..268
BprCcP01 317 1e-107 18..267 7..256
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 709553..709642 90 N° 2 709710..709789 80 N° 3 709845..709950 106 N° 4 710017..710119 103
N° 5 710179..710243 65 N° 6 710346..710489 144 N° 7 710561..710611 51 N° 8 710700..710759 60
N° 9 710819..710877 59 N° 10 710948..711017 70  
join(709553..709642,709710..709789,709845..709950,710017..710119,710179..710243, 710346..710489,710561..710611,710700..710759,710819..710877,710948..711017)


exon

Literature and cross-references BnaCcP02
Literature Keeling,P.J. PEPdbPub (http://amoebidia.bcm.umontreal.ca/public/pepdb/agrm.php). Bigelowiella natans
DNA ref. JGI genome:   scaffold_34 (709553..711018)
EST ref. GenBank:   DR039779 [3' end]
Cluster/Prediction ref. JGI gene:   48901
Protein sequence: BnaCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   275
PWM (Da):   %s   30551.8  
PI (pH):   %s   6.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSCPFGFTAKSYEKEADLRSAMKEAMINSKGNCCPFAMRLAWHASGTYDAKSKTGGSNGATMRFKPESTDGANAGLDIMRDIVAPIKEKFPVSLADIWTYAGKMSIEESGGPKIQFSFGRGDDETGKNCPENGRLPDAAKGAQHLRVFYRMGFDDRAIVALSGGHNLGSCHTDRSGFSGPWTTNPLKFDNEYYINLVEKEWIEKKWDGPFQYTDKATGKLMMLPTDIALMKDEKFKVIVEEYAKDKDSFFKDFAKYFSQLLHLGCEEAMKAKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTGCCCATTCGGATTCACCGCTAAGTCCTATGAGAAGGAGGCGGACCTTCGCTCTGCCATGAAGGAAGCCATGATCAACTCTAAGGTGGTTTTTGTGAATTTTCAATGCGGACAT
CCCTTTATCGCATCATATCAACTTCGTGGTTTTCCAGGGAAACTGCTGCCCATTCGCTATGCGCCTGGCGTGGCATGCGTCTGGAACCTATGACGCTAAATCCAAGACTGGTGGCAGGTT
ACTAATTTAAGCAGAACATTGCCAATTGTTTCTAAACTTTTGTTCTTTTAAGCAACGGTGCTACTATGCGGTTCAAGCCCGAGTCCACAGATGGCGCGAATGCAGGACTCGACATCATGC
GTGACATTGTTGCTCCCATCAAGGAGAAATTCCCTGAC
GTATGTCTCGCGTAAAATAATAGACTGAAGTCGGACAGAATTTTGACAATCATAACAATAAATTAGGTATCCCTCGCTGACA
TTTGGACCTACGCTGGGAAAATGTCGATCGAAGAGAGTGGAGGACCCAAGATTCAATTCTCTTTCGGTCGCGGCGACGATGAAACCG
GTAGGGATATCATCATGTACAATCACGTCTCCA
AGTACTGACAATTCCAATTTTCATAGGAAAGAACTGCCCAGAGAATGGCCGCCTTCCTGATGCAGCAAAGGGAGCACAGCACCTCCGCGATGTAACCAATTTCATTTGATTTTTTCTTCC
TAGCGAAGCCAAATACGATCGTTTCAATCATTTGTGTTTCGATATGATAATGCTATATGGATCGAAAAATTAGGTTTTCTACCGCATGGGCTTTGACGACAGGGCCATTGTCGCTCTGAG
CGGCGGACACAACTTGGGCAGCTGCCATACCGATCGTAGCGGTTTCAGCGGACCCTGGACCACGAATCCTCTCAAGTTCGATAATGAATACTACATC
GTAAGGCTTTATTTTTTCATTTG
TTGTCATGAGACCACCATATCATCTTCTTTTTACAAAAATCCTTTAAGAATCTTGTGGAGAAGGAATGGATTGAGAAGAAATGGGACGGTCCTTTCCAGGTCAGTGACCTTACAAACCTT
TTCCCTCATATTTGACTGAGTCGGGTGCTCACTGAAGCTTTCGATACCTTTACCTTGTGTTTCACAGTACACGGACAAAGCAACTGGAAAGCTTATGATGCTTCCTACTGACATTGCCCT
GATGAAG
GTGGTGTCAAAACATTCATATTAGTCTATGTTTGTCATTGATTTTTTATTTGTTGGTAGGATGAGAAGTTCAAGGTTATTGTTGAAGAATACGCCAAAGACAAGGACTCTTTC
TTCAA
GTAAATCACGTGAATCATCGTTTCGCCGTGGAGACTAAACTGATTGGATTGCCATTCGAAATATTTACAGAGACTTCGCGAAATACTTCTCCCAGCTGCTTCATCTAGGATGTGA
AGAAGCAATGAAGGCAAAGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTGCCCATTCGGATTCACCGCTAAGTCCTATGAGAAGGAGGCGGACCTTCGCTCTGCCATGAAGGAAGCCATGATCAACTCTAAGGGAAACTGCTGCCCATTCGCTATGCGCCTG
GCGTGGCATGCGTCTGGAACCTATGACGCTAAATCCAAGACTGGTGGCAG
CAACGGTGCTACTATGCGGTTCAAGCCCGAGTCCACAGATGGCGCGAATGCAGGACTCGACATCATGCGT
GACATTGTTGCTCCCATCAAGGAGAAATTCCCTGAC
GTATCCCTCGCTGACATTTGGACCTACGCTGGGAAAATGTCGATCGAAGAGAGTGGAGGACCCAAGATTCAATTCTCTTTCGGT
CGCGGCGACGATGAAACCG
GAAAGAACTGCCCAGAGAATGGCCGCCTTCCTGATGCAGCAAAGGGAGCACAGCACCTCCGCGATGTTTTCTACCGCATGGGCTTTGACGACAGGGCCATT
GTCGCTCTGAGCGGCGGACACAACTTGGGCAGCTGCCATACCGATCGTAGCGGTTTCAGCGGACCCTGGACCACGAATCCTCTCAAGTTCGATAATGAATACTACATC
AATCTTGTGGAG
AAGGAATGGATTGAGAAGAAATGGGACGGTCCTTTCCAG
TACACGGACAAAGCAACTGGAAAGCTTATGATGCTTCCTACTGACATTGCCCTGATGAAGGATGAGAAGTTCAAGGTTATT
GTTGAAGAATACGCCAAAGACAAGGACTCTTTCTTCAA
AGACTTCGCGAAATACTTCTCCCAGCTGCTTCATCTAGGATGTGAAGAAGCAATGAAGGCAAAGAAGTAG

Retrieve as FASTA