Entry information : TpsCcP04
Entry ID 2555
Creation 2005-12-28 (Nenad Bakalovic)
Last sequence changes 2005-12-28 (Nenad Bakalovic)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-08-31 (Christophe Dunand)
Peroxidase information: TpsCcP04
Name TpsCcP04
Class Cytochrome C peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Bacillariophyta Coscinodiscophyceae Thalassiosiraceae Thalassiosira
Organism Thalassiosira pseudonana    [TaxId: 35128 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TpsCcP04
start..stop
S start..stop
TpsAPx05 304 3e-102 64..353 1..291
AcaAPx-CcP02 120 2e-31 53..238 110..301
AcaAPx-CcP01 113 2e-29 53..224 48..225
SYgrAPx02 90 5e-21 51..222 31..215
Literature and cross-references TpsCcP04
Literature Madera, M. et al., The SUPERFAMILY database in 2004: additions and improvements, Nucl. Acids Res., 32, D235-D239.
DNA ref. JGI genome:   scaffold_21 (44115..176995)
mRNA ref. JGI transcript:   102479
Protein sequence: TpsCcP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   416 (396)
PWM (Da):   %s   46552.49 (44545.5)  
PI (pH):   %s   4.51 (4.47) Peptide Signal:   %s   cut: 23 range:21-416
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MMNSRFATAT LLAALGIASS SCVDKSTYYK IDDDVKAIAD SIDNEDDLSH FYGGIVRLVA HDFMDYDAHG DNGMGSDGCI EFDHPTNAGL ETVWCDDCEI TKLYNKKYSH ISKADFWIIA  GNAVIRQTAI GDGLDMAGTF YWGRLDADQC SGSGDRVPVG TSCREVEATF LESMGLEWED AVALMGAHTL GQAHDEFSGH DGYWVPPEES VIFDKRYYEE LILRAWRPRK DGEEKQDWTS  THPDNPEPKF MLNTDMCLFY DIETSYPCCS RTDLFRSNGA NRCDYEEDYS HTECMKYSSD SSRMAAVRAV VKFLGGTGPN SNQTPFYQAF EKAWYKATMN GADNLKPLKN SCSDSCTLGE 
ITCCLCTRML RHVVCSTPYT ASQLYPFEYG YIMPRRPFPA SCCLLSIVCI YYTIDR 

Retrieve as FASTA  
Remarks Is it a CCP???? "AWRPRKDGEEKQDWTSTHPDNPEPKFMLNTDMCLFYDIETSYPCCSR" from DNA (JGI).