Entry information : PtrAPx01
Entry ID 2571
Creation 2005-12-20 (Nenad Bakalovic)
Last sequence changes 2015-09-25 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-04 (Catherine Mathe)
Peroxidase information: PtrAPx01
Name PtrAPx01
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Bacillariophyta Bacillariophyceae Phaeodactylaceae Phaeodactylum
Organism Phaeodactylum tricornutum    [TaxId: 2850 ]
Cellular localisation Stromal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtrAPx01
start..stop
S start..stop
TpsAPx02 496 8e-179 1..331 1..330
GtAPx02 480 7e-172 4..328 27..357
TocAPx01 443 3e-158 31..331 8..309
GtAPx01 419 6e-148 25..320 41..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 522697..523138 442 N° 2 522047..522600 554  
complement(join(522047..522600,522697..523138))


exon

Literature and cross-references PtrAPx01
Literature Scala,S. et al., Genome properties of the diatom Phaeodactylum tricornutum Plant Physiol. 129 (3), 993-1002 (2002)
Protein ref. UniProtKB:   B7G386
DNA ref. JGI genome:   chr_13 (523138..522047)
EST ref. GenBank:   CD377590.1 [5' end]   CT880170.1 [3' end]
Cluster/Prediction ref. UniGene:   Ptc.1981
Protein sequence: PtrAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (314)
PWM (Da):   %s   35656.52 (33785.6)  
PI (pH):   %s   4.85 (4.77) Peptide Signal:   %s   cut: 18 range:18-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKFTSFAFLALAASANAFTQPASFGAARSFSTSLDVSKKDLEGAQTMIDKIIDDTNANPVFVRLAWHDSGTFDVNVEKEWPASGGAIGSIRFDPEINHGANAGLSGAVKLLEPVKESFPDVSFADIFQMASARSIELAGGPKIDMKYGRVDASGPENCSAEGNLPDAEPGPDGKYGGPGGSASTEDKTPNGHLRKVFYRMGLNDEEIVALSGAHSFGRAYKDRSGLGAEKTKFTDGSKQIRADGKEAKYNPGGSAWTKNWLVFDNSYFTTIPDESADPELLKLSTDKTLFGDEDFKPFAEKFRDSQDEFFASYAKAHKKLSELGSKFEAVE

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 13, 1 intron) and 23 ESTs (6 included in the Unigene and many discrepancies for the 3'end). The contig contains two APx.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTCACTTCCTTTGCCTTCCTCGCACTTGCGGCTTCCGCCAATGCCTTCACACAGCCCGCTTCCTTCGGGGCCGCTCGCAGCTTCTCCACTTCTTTGGATGTTTCCAAGAAGGAT
TTGGAGGGCGCTCAAACGATGATTGACAAGATCATTGACGATACGAACGCCAACCCAGTCTTTGTTCGTCTTGCTTGGCATGACTCGGGTACTTTCGACGTCAATGTTGAAAAAGAGTGG
CCGGCATCGGGTGGGGCTATTGGCAGCATCCGCTTCGACCCCGAAATCAACCATGGCGCCAACGCTGGTTTGTCGGGAGCCGTCAAGCTTTTGGAACCCGTTAAGGAAAGCTTCCCCGAT
GTCAGTTTCGCTGACATTTTCCAAATGGCCTCCGCCCGTTCGATCGAACTTGCCGGAGGTCCCAAGATTGACATGAAGTACG
GTACGTTGTGACTAACCTGCCTAGTGTGATGCCAATTT
TCGAATCGTGTATGGCTTTGGCTTCGAATGCTCACCCTTCTGGTTATGTTGCCTTTAGGACGTGTTGATGCGTCCGGTCCTGAAAACTGTTCCGCTGAAGGAAACCTTCCCGACGCGGAA
CCGGGTCCGGACGGAAAGTATGGTGGTCCGGGAGGCAGCGCTTCAACCGAAGACAAAACCCCCAACGGTCACTTGCGCAAGGTGTTCTATCGCATGGGCTTGAACGACGAGGAAATCGTG
GCACTATCGGGTGCACACAGTTTCGGTCGCGCGTACAAGGACCGCTCCGGACTTGGCGCTGAAAAGACCAAATTCACTGACGGCAGTAAACAAATTCGAGCGGACGGGAAGGAAGCCAAG
TACAACCCCGGTGGTAGTGCATGGACCAAGAACTGGTTGGTTTTCGATAATAGCTACTTCACAACGATCCCCGACGAGTCCGCTGATCCAGAACTTCTCAAGCTTTCGACTGACAAAACT
CTCTTCGGCGATGAAGACTTCAAGCCCTTTGCTGAAAAGTTCCGTGATTCACAGGATGAGTTCTTCGCTTCGTACGCAAAGGCGCATAAAAAGCTTTCCGAGCTCGGATCCAAGTTTGAA
GCCGTCGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTCACTTCCTTTGCCTTCCTCGCACTTGCGGCTTCCGCCAATGCCTTCACACAGCCCGCTTCCTTCGGGGCCGCTCGCAGCTTCTCCACTTCTTTGGATGTTTCCAAGAAGGAT
TTGGAGGGCGCTCAAACGATGATTGACAAGATCATTGACGATACGAACGCCAACCCAGTCTTTGTTCGTCTTGCTTGGCATGACTCGGGTACTTTCGACGTCAATGTTGAAAAAGAGTGG
CCGGCATCGGGTGGGGCTATTGGCAGCATCCGCTTCGACCCCGAAATCAACCATGGCGCCAACGCTGGTTTGTCGGGAGCCGTCAAGCTTTTGGAACCCGTTAAGGAAAGCTTCCCCGAT
GTCAGTTTCGCTGACATTTTCCAAATGGCCTCCGCCCGTTCGATCGAACTTGCCGGAGGTCCCAAGATTGACATGAAGTACG
GACGTGTTGATGCGTCCGGTCCTGAAAACTGTTCCGCT
GAAGGAAACCTTCCCGACGCGGAACCGGGTCCGGACGGAAAGTATGGTGGTCCGGGAGGCAGCGCTTCAACCGAAGACAAAACCCCCAACGGTCACTTGCGCAAGGTGTTCTATCGCATG
GGCTTGAACGACGAGGAAATCGTGGCACTATCGGGTGCACACAGTTTCGGTCGCGCGTACAAGGACCGCTCCGGACTTGGCGCTGAAAAGACCAAATTCACTGACGGCAGTAAACAAATT
CGAGCGGACGGGAAGGAAGCCAAGTACAACCCCGGTGGTAGTGCATGGACCAAGAACTGGTTGGTTTTCGATAATAGCTACTTCACAACGATCCCCGACGAGTCCGCTGATCCAGAACTT
CTCAAGCTTTCGACTGACAAAACTCTCTTCGGCGATGAAGACTTCAAGCCCTTTGCTGAAAAGTTCCGTGATTCACAGGATGAGTTCTTCGCTTCGTACGCAAAGGCGCATAAAAAGCTT
TCCGAGCTCGGATCCAAGTTTGAAGCCGTCGAATAA

Retrieve as FASTA