Entry information : HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Entry ID 2652
Creation 2005-12-25 (Marcia Pinheiro Margis)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Name (synonym) HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue types Buds
Hypocotyls
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx07
start..stop
S start..stop
LeGPx08 270 9e-95 1..164 1..167
NtGPx08-1A 269 2e-94 1..167 1..170
StGPx08 269 4e-94 1..164 1..167
PtGPx08 263 6e-92 1..166 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 146707950..146707994 45 N° 2 146708593..146708669 77 N° 3 146708883..146708944 62 N° 4 146709832..146709950 119
N° 5 146710040..146710207 168 N° 6 146711166..146711198 33  
join(146707950..146707994,146708593..146708669,146708883..146708944,146709832..1 46709950,146710040..146710207,146711166..146711198)


exon

Literature and cross-references HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Literature Roeckel-Drevet,P., Gagne,G., Tourvielle de Labrouhe,D.,Dufaure,J.P., Nicolas,P. and Drevet,J.R. Molecular characterization, organ distribution and stress-mediated nduction of two glutathione peroxidase-encoding mRNAs in sunflower (Helianthus annuus). Physiol. Plantarum 103, 385-394 (1998)
Protein ref. UniProtKB:   O23970
DNA ref. HanXRQ genome:   HanXRQChr03 (146707950..146711198)
mRNA ref. GenBank:   Y14429
Cluster/Prediction ref. HanXRQ:   HanXRQChr03g0086581 UniGene:   Han.862
Protein sequence: HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18720.52  
PI (pH):   %s   4.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAQPKKTLYDFTVKDAKGNDVDLSVYKGKVVLIVNVASKCGLTNNNYDELNQIYLKYKEGFEILAFPCNQFGAQEPGTNEEIVDFVCTKFKSEFPIFDIDVNGENAAPVYEFLKTGFYGILGGDIQWNFSKFLVDKNGQPVDRYYPTTSPLTVERDIQKLLGLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic, 1 mRNA and 3 ESTs. Cultivar="Emil" and "psc8".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCCAACCCAAGAAAACCCTCTATGATTTCACAGTCAAGGTTCCGAATTTCTCTCTCAACAACCCTAATTTCAATTTTCATTTTTTTTTGTGGAATTGATTAACAATAATTAGA
ATTGACAGGCTAATCAAAACCCAGAAATTATGAACAAGTTTATTTCACTAATCTGTTGAAAAGATAGAAAAAATTCAACCTTTTCTTATTTTTATGTTAAATATTGGTTTTGACCATGTA
AAGTTTTTGTTACTAATTTTTTATCATGCATGTGGCTTTTTTAGTTTTTGTTACAGGGTTTTATTTAGTTAGTTAGATAGTTAGTTATTGAATTTGGATTGGAAGTTTCAAGATGCATGT
TAGTTTTTCAGTTAGAAGCCTCTGTTTGACACACAAAAGTCAATGATCCAGATTGAGTCTTTCTTTGAAACTCTATAGTGTCTACAGTATACACCTTCAGTTTTTAAATTAACCAAAAAA
AAATTAGGCCTCCAATATTAAGTTAAATTAAATTTATTAGTTAGTTTGGACCTCTGCCACTTACTTTAGGTTGATCTAGCTTTGGATTGATCTCATAAGTTTTGTGTTATTTTTTAGTAT
TTAATTTTGGCTTTTTGGTGATTTAATCTTCGATTCGGTGCAGGATGCTAAGGGTAACGATGTAGACCTTAGCGTATACAAGGGAAAAGTTGTACTTATTGTTAACGTTGCGTCCAAGTG
GTACGCGCTCACTATCTTCACTACTATTTTGTTTGAATGTTCTTGCAGCCCATTTGCCCTTTTGTAATTTAAAAACAAGCTCAGCTTTTCTTTTCTTTTTTCTTTTTTCTTTTTTTTTTT
TTTTTGCTATTTAACTACCTTTTTAAATAGGCTTTGTGATTGTATCTCCTGAAGTTGCTTATAGTCAATTGTGTTGTTGGTTCTTTGTGGCAGTGGGCTTACAAACAACAACTATGATGA
ACTGAATCAGATTTATTTGAAGTACAAGGAGAAAG
GTTTGTAGTTTTTGGTTTCGGTTTCAAGTTTGATATAAAACTCGTTTCATTCATACCGAAGCTGATGTTCAAGATGTCAGTTTGG
TATGGAGTGATCGGAATTACGGAAGATGATGTTCGACTTCTTATTTGTTGCAAAACATATAAAAAGATTGTAAATTGCAGAAAAAAAAATAATGAGTTTGAAATATAATCATTGTCAGTT
ACACCTTTTATAAAGAATGATATATTATTGCAAGAAAAGTTTGGTTTTTTTATTTGTATTTTATAATGATGGTGTCAGTTAGTAGTTAAAGTAGAAGTAGAACTAGGGCTGCAAACGAAC
CAAATGTTCGGCGAACAGTTCGTGAACTGTTCGGCGGGAAGTTCGTTTGTGTTCGTTCGTTTATTAAACAAACGAACACGAACAAGAAATTTTGTTCGTTTAGTTAAATGAACAAACATG
AACAGAGGTCGTGTTCGTTCGTTTATGTTCGTGAACGTTCGGTAATGTGTTCGTTTGTGTTCGATAGTTCATTAGTGTTTTTAGTTTTTATATTTATTTAAATACTTCAAAATTCCGACA
AATTAAATATCTAATAAGTGTCAGTGTATTATATATTTTGTTCATGAATGATTGTTTGTGTTCGTTTGTTTCCATTTGTGTTTATGAACATTAGTTTGTGCTCATTTGTGTTCGTCAACG
CTTGTTTTTGTTTCTTGCCTAAAATTAACAAACAAACACAAACGAACACGAACATAAAATCTCGTTCGATAAGTGTTCGTGAACTGTTCGCGAACACATATATTTCTTAACAAACGAACA
CGAACAAGGTCTTGTTCGTCTTCGTTTGGTTCGTTTGCAGCCCTAAGTAGAACTGTATAATGTTCAACTTCAATGAATATAGGTTTTGAGATCTTGGCATTTCCATGCAACCAATTTGGA
GCTCAGGAACCAGGAACCAACGAAGAAATTGTCGACTTCGTCTGCACCAAATTCAAATCAGAATTTCCCATCTTTGACAAG
GTGAAATTCAAACAACCCACCATGAAAAAGCTACTAAAG
TTTCAAAATTTATCAAAAAAGATTAAAACTTTGATGCAATTTCAACACAGATTGATGTGAATGGCGAGAACGCTGCACCTGTATACGAGTTCTTGAAAACAGGGTTCTATGGAATTCTTG
GGGGAGACATTCAATGGAACTTTTCCAAGTTCTTGGTTGATAAAAACGGCCAACCTGTCGACCGCTACTATCCCACAACTTCCCCTCTTACAGTCGAG
GTAAAAAGACAGAAATACCCTT
TTAAACAACCAATCTTAGGGGTGCTCATCCGACTGAATAACGAATTTTCAAGTTACTCGAATCGAATTTATTGAATAATTTTTTATTTTGCTGGAATTCAAATTCGATTAAAAACTGGTC
AATTCGATTCAAATTCGTATTCAAATTAAAACGCCAATTCGAATTGGAATCGAATTCGGATAATTCGAATAAATTCGTTTTGATTCAAATCAATTTAAAATATTTAAATTCGTTATGGGC
TATTTTAGGACTTAGATTAAAGAGTAAATTGTCATTTTAGTCCCTGAGTTTTTGTCCAAATTGTCATTTTAGTCCAAATAGTTTTTTTTTCTCCTCTGGATCCCCGACTTTTCCTTTTTT
TTTTTTGGTCATTTTGATCACATTGCCTAACTTAATCTAAAAACCAGGTTATAATCAGGGGTATTTTGGCATTAAATTATTATGAGGTTTATAAATTATGTTGTAAACTACCCCTGGTTA
TCACTACACAATAGTTATGCCAAAAATACCCCTGGTTATAACCAGATTTTTAGATTAAGTTAGGCAATGTGATCAAAATGGCAAGAAAATGGAAAAGTCAGGGACCCTCTGGATGAAAAA
AAAAAAACTATTTGGACTAAAATGGCAATTCGGACCAAACCTCAAGGACTAAAATGGAATTTACTCTAGATTAAATCTATAGATTAGCTTATACTATAGCCCAAATTAAAGTTACATGTG
TATTATTTATAAATATAATAAATAAAAATGTATAATTTGAATACGAATTTAAAATTATAAACTCGTATTTGATTTACTGGACTCGAATTCGAATTTCAATTTTTTGATAATCAAATCGAA
TTGAGTCAAATTTCTAATTTTTCAAATCGGAATCGAATTCTAAACACTCTTGAATCACACTACTTCATCTTGCATAACTCGTGTTGTTTTTTGCAGAGAGACATTCAGAAGCTCTTGGGT
CTCCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCCAACCCAAGAAAACCCTCTATGATTTCACAGTCAAGGATGCTAAGGGTAACGATGTAGACCTTAGCGTATACAAGGGAAAAGTTGTACTTATTGTTAACGTTGCGTCCAAG
TG
TGGGCTTACAAACAACAACTATGATGAACTGAATCAGATTTATTTGAAGTACAAGGAGAAAGGTTTTGAGATCTTGGCATTTCCATGCAACCAATTTGGAGCTCAGGAACCAGGAACC
AACGAAGAAATTGTCGACTTCGTCTGCACCAAATTCAAATCAGAATTTCCCATCTTTGACAAG
ATTGATGTGAATGGCGAGAACGCTGCACCTGTATACGAGTTCTTGAAAACAGGGTTC
TATGGAATTCTTGGGGGAGACATTCAATGGAACTTTTCCAAGTTCTTGGTTGATAAAAACGGCCAACCTGTCGACCGCTACTATCCCACAACTTCCCCTCTTACAGTCGAG
AGAGACATT
CAGAAGCTCTTGGGTCTCCTCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAAAC CAAAAAGTAT CAAATATACG GCTGTTGGGG CGTCCCTTTT GGAATATATT CGCTTGTTTT TGTCACGTTT TGAATTGGAG CCACCAATGC CAAATAAATT CAATTAATTC  CGCCAAATAA ATTCAATAAT AATAATACAC ACCTGATCTG ATCATCTTGT TGCCCATTTC AACAATCAAA AACCAGCAAT CATCCATGGC TGCCCAACCC AAGAAAACCC TCTATGATTT  CACAGTCAAG GATGCTAAGG GTAACGATGT AGACCTTAGC GTATACAAGG GAAAAGTTGT ACTTATTGTT AACGTTGCGT CCAAGTGTGG GCTTACAAAC AACAACTATG ATGAACTGAA  TCAGATTTAT TTGAAGTACA AGGAGAAAGG TTTTGAGATC TTGGCATTTC CATGCAACCA ATTTGGAGCT CAGGAACCAG GAACCAACGA AGAAATTGTC GACTTCGTCT GCACCAAATT  CAAATCAGAA TTTCCCATCT TTGACAAGAT TGATGTGAAT GGCGAGAACG CTGCACCTGT ATACGAGTTC TTGAAAACAG GGTTCTATGG AATTCTTGGG GGAGACATTC AATGGAACTT  TTCCAAGTTC TTGGTTGATA AAAACGGCCA ACCTGTCGAC CGCTACTATC CCACAACTTC CCCTCTTACA GTCGAGAGAG ACATTCAGAA GCTCTTGGGT CTCCTCTAGA TTTCAAGATT  TGCAGAAACT GTTTTAATGT GCATCTTTCA TTTCAAGAAT GCCCCTATGT TGAATAATGG CATACTTATC TTTCATTTTC TGCTGTATGG TTTAAACCTA TTTAATAATA TTTGCAAAAA 

Retrieve as FASTA