Entry information : SbPrx59 (Sobic.003G140700.1 [2.1] / Sb03g011990 [1.4])
Entry ID 2689
Creation 2008-10-20 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx59 (Sobic.003G140700.1 [2.1] / Sb03g011990 [1.4])
Name (synonym) SbPrx59 (Sobic.003G140700.1 [2.1] / Sb03g011990 [1.4])
Class Class III peroxidase    [Orthogroup: Prx079]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Pannicles
Seedlings
Inducers Dark growth
Light growth
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx59
start..stop
S start..stop
SbPrx58 700 0 1..349 1..348
ZmPrx107 674 0 1..349 1..348
ZmPrx44 669 0 1..349 1..348
SiPrx08 619 0 25..349 24..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13762832..13763062 231 N° 2 13763173..13763991 819  
join(13762832..13763062,13763173..13763991)


exon

Literature and cross-references SbPrx59 (Sobic.003G140700.1 [2.1] / Sb03g011990 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (13762832..13763991)
Protein sequence: SbPrx59 (Sobic.003G140700.1 [2.1] / Sb03g011990 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (320)
PWM (Da):   %s   37899.44 (35123.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.98 (6.83) Peptide Signal:   %s   cut: 30 range:30-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSAAVLCALVAVQAAALLLATVPSAQAKELEVGYYGKKCKGVENVVKWHVIKAIKANRRTGAALVRLLFHDCFVRGCDGSVLLDASSDNPHPEKEAPVNIGLAAFDVLEEIKAAVEKRCPGVVSCSDILIYAARDAASALSNGHVHFAVPAGRLDGFVSKADEAQAELPDSTHDVQQLIDNFARKNFTVEELVILTGAHSIGQGHCSSFRGRLSEPSSQITPAYRDLLNYKCSQGSNPPVDNNVRDEDYDVVAKFVAGFTSRVRKIPDFLDNSFYHNNLAKIVTFHSDWTLLTHKEALGHVVEYAENGTLWDEDFSESLLKLSKLPMPAGSKGEIRKKCSVVNHRLY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1) and 11 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCAGTCCTCTGCGCCCTTGTGGCTGTCCAGGCGGCGGCGCTCCTCCTCGCCACCGTGCCGTCGGCGCAGGCCAAAGAGCTGGAGGTCGGCTACTACGGCAAGAAG
TGCAAGGGCGTGGAGAACGTGGTGAAGTGGCATGTCATCAAGGCTATCAAGGCCAACCGCCGCACCGGCGCCGCACTCGTCCGCCTCCTCTTCCATGACTGCTTCGTCAGG
GTAAGCAGC
ACTAAGCACTCAAGCATGCCAATTCATTATAGTAGAGTGTGTGGCGTGAAATGCATGTACAACTAATTGACGGTAAACTAAATAACTAATTAACCATGCAGGGGTGTGATGGTTCTGTCC
TCCTGGACGCTTCCTCCGACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGCCTCGCCGCCTTCGACGTCCTGGAGGAGATCAAGGCCGCCGTCGAGAAGAGGTGCCCCGGCG
TGGTCTCCTGCTCCGACATCCTCATCTACGCCGCCCGCGACGCGGCCAGCGCCCTGAGCAACGGCCACGTCCACTTCGCCGTCCCCGCCGGGCGCCTGGACGGCTTCGTCTCCAAGGCCG
ATGAGGCCCAGGCGGAGCTCCCGGACTCCACCCACGACGTGCAGCAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCGTGGAGGAGCTGGTCATCCTCACCGGCGCGCACTCCATCG
GCCAGGGCCACTGCTCCTCCTTCAGAGGCCGCCTCTCCGAGCCGTCGAGCCAGATCACCCCGGCGTACCGCGACCTGCTCAACTACAAGTGCTCCCAGGGATCGAACCCGCCCGTGGACA
ACAACGTCCGCGACGAGGACTACGACGTGGTGGCCAAGTTCGTGGCGGGGTTCACCAGCCGGGTGCGCAAGATCCCGGACTTCCTGGACAACTCCTTCTACCACAACAACCTCGCCAAGA
TCGTCACCTTCCACTCCGACTGGACGCTGCTCACGCACAAGGAGGCGCTCGGCCACGTCGTCGAGTACGCCGAGAACGGCACGCTGTGGGACGAGGACTTCTCCGAGTCGCTGCTCAAGC
TCAGCAAGCTGCCCATGCCAGCAGGAAGCAAGGGAGAGATCAGGAAGAAGTGCAGCGTCGTCAACCACCGCCTGTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCAGTCCTCTGCGCCCTTGTGGCTGTCCAGGCGGCGGCGCTCCTCCTCGCCACCGTGCCGTCGGCGCAGGCCAAAGAGCTGGAGGTCGGCTACTACGGCAAGAAG
TGCAAGGGCGTGGAGAACGTGGTGAAGTGGCATGTCATCAAGGCTATCAAGGCCAACCGCCGCACCGGCGCCGCACTCGTCCGCCTCCTCTTCCATGACTGCTTCGTCAGG
GGGTGTGAT
GGTTCTGTCCTCCTGGACGCTTCCTCCGACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGCCTCGCCGCCTTCGACGTCCTGGAGGAGATCAAGGCCGCCGTCGAGAAGAGG
TGCCCCGGCGTGGTCTCCTGCTCCGACATCCTCATCTACGCCGCCCGCGACGCGGCCAGCGCCCTGAGCAACGGCCACGTCCACTTCGCCGTCCCCGCCGGGCGCCTGGACGGCTTCGTC
TCCAAGGCCGATGAGGCCCAGGCGGAGCTCCCGGACTCCACCCACGACGTGCAGCAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCGTGGAGGAGCTGGTCATCCTCACCGGCGCG
CACTCCATCGGCCAGGGCCACTGCTCCTCCTTCAGAGGCCGCCTCTCCGAGCCGTCGAGCCAGATCACCCCGGCGTACCGCGACCTGCTCAACTACAAGTGCTCCCAGGGATCGAACCCG
CCCGTGGACAACAACGTCCGCGACGAGGACTACGACGTGGTGGCCAAGTTCGTGGCGGGGTTCACCAGCCGGGTGCGCAAGATCCCGGACTTCCTGGACAACTCCTTCTACCACAACAAC
CTCGCCAAGATCGTCACCTTCCACTCCGACTGGACGCTGCTCACGCACAAGGAGGCGCTCGGCCACGTCGTCGAGTACGCCGAGAACGGCACGCTGTGGGACGAGGACTTCTCCGAGTCG
CTGCTCAAGCTCAGCAAGCTGCCCATGCCAGCAGGAAGCAAGGGAGAGATCAGGAAGAAGTGCAGCGTCGTCAACCACCGCCTGTACTGA

Retrieve as FASTA