Entry information : SbPrx110 (Sobic.009G032800.1 [2.1] / SB09G002760 [1.4])
Entry ID 2708
Creation 2006-01-12 (Christophe Dunand)
Last sequence changes 2006-01-12 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx110 (Sobic.009G032800.1 [2.1] / SB09G002760 [1.4])
Name (synonym) SbPrx110 (Sobic.009G032800.1 [2.1] / SB09G002760 [1.4])
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx110
start..stop
S start..stop
ZmPrx128 564 0 1..334 3..338
SiPrx102 561 0 3..333 1..328
SiPrx106 551 0 6..332 2..324
OsPrx68 420 2e-148 26..334 27..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3002490..3002735 246 N° 2 3001471..3002229 759  
complement(join(3001471..3002229,3002490..3002735))


exon

Literature and cross-references SbPrx110 (Sobic.009G032800.1 [2.1] / SB09G002760 [1.4])
Literature PlantGDB
DNA ref. Phytozome 12:   chromosome_9 (3002735..3001471)
Protein sequence: SbPrx110 (Sobic.009G032800.1 [2.1] / SB09G002760 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (301)
PWM (Da):   %s   34954.22 (31709.6) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.19 (6.72) Peptide Signal:   %s   cut: 34 range:34-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMPTSTSTCKQATLLMAFVVAAALSTATTSSAQSPLQYNFYGTSCPLAEATVRNVTAGIIANDPTMGAAFMRLFFHDCFVRGCDASILIDPTSSNTQVEKKAIALRGYAAVNTIKAAVEAVCPGVVSCADILAFAARDTAVVSGGFPTFDMPSGRRDGTVSSFIEVLQNIPSPTFKLQDLINNFAKKGLNVDDLVILSGAHSFGQAHCSFCNGRLYPTVDPTMDGTYAAGLKTVCPAPGSGGGDPVIDNNRVTDPNVLSNQYYSNLMAGKVLFVSDQQLMNTSYTAAKVANSSADAATWMSQFQTALVKMGSIQVLTGTAGQVRKYCNVVNSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGCCGACGTCGACGTCAACCTGCAAGCAGGCCACGCTACTCATGGCGTTCGTCGTGGCTGCTGCCCTGAGCACGGCGACGACGTCGTCGGCACAGTCGCCGCTGCAGTACAAC
TTCTACGGCACATCGTGCCCGCTGGCGGAGGCCACGGTGCGCAACGTCACCGCTGGGATCATCGCCAACGACCCCACCATGGGCGCCGCCTTCATGCGCCTCTTCTTCCATGACTGCTTC
GTCAGG
GTAGGTATATATATATAAAACTTCTCTTTTAGATATATACTAAAGTCACCTCAGGGTATAACTACAGTACATTCTTATTATCATTGTCATCACACGAGAACACCACGTCGTCGT
GTTATTCCAAAATGACATATATTGCCATGTTTGGCAACTCTCAACATATATATTTTAGTACTCGCATAGTACAATCATCAGCACGTACGTAGCTAGTATATGGTAATAATGCATGGCTCC
GGCGGCTTAATTAATTTGCACTGCAGGGCTGCGACGCCTCGATCCTGATCGACCCGACGAGCAGCAACACGCAGGTGGAGAAGAAGGCGATCGCGCTGCGCGGGTACGCCGCCGTGAACA
CGATCAAGGCGGCCGTGGAGGCGGTGTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTGGCCTTCGCGGCGCGGGACACGGCGGTCGTCTCCGGCGGCTTCCCCACCTTCGACATGCCCT
CCGGCCGCCGCGACGGGACGGTGTCCAGCTTCATCGAGGTGCTGCAGAACATCCCGTCCCCGACCTTCAAGCTCCAGGACCTCATCAACAACTTCGCCAAGAAGGGCCTCAACGTCGACG
ACCTCGTCATTCTCTCCGGCGCGCACTCCTTCGGCCAGGCGCACTGCTCCTTCTGCAACGGCCGGCTGTACCCTACCGTCGACCCCACCATGGACGGCACCTACGCCGCCGGGTTGAAGA
CGGTGTGCCCGGCGCCGGGCAGCGGCGGCGGCGACCCGGTGATCGACAACAACCGGGTGACGGACCCCAACGTGCTCAGCAACCAGTACTACAGCAACCTGATGGCGGGGAAGGTGCTCT
TCGTGTCGGACCAGCAGCTCATGAACACAAGCTACACGGCGGCCAAGGTGGCCAACAGCTCCGCTGACGCTGCCACGTGGATGAGCCAGTTCCAAACGGCGCTGGTGAAGATGGGCAGCA
TCCAGGTGCTCACCGGGACGGCCGGCCAGGTCAGGAAGTACTGCAATGTCGTCAACAGCAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGCCGACGTCGACGTCAACCTGCAAGCAGGCCACGCTACTCATGGCGTTCGTCGTGGCTGCTGCCCTGAGCACGGCGACGACGTCGTCGGCACAGTCGCCGCTGCAGTACAAC
TTCTACGGCACATCGTGCCCGCTGGCGGAGGCCACGGTGCGCAACGTCACCGCTGGGATCATCGCCAACGACCCCACCATGGGCGCCGCCTTCATGCGCCTCTTCTTCCATGACTGCTTC
GTCAGG
GGCTGCGACGCCTCGATCCTGATCGACCCGACGAGCAGCAACACGCAGGTGGAGAAGAAGGCGATCGCGCTGCGCGGGTACGCCGCCGTGAACACGATCAAGGCGGCCGTGGAG
GCGGTGTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTGGCCTTCGCGGCGCGGGACACGGCGGTCGTCTCCGGCGGCTTCCCCACCTTCGACATGCCCTCCGGCCGCCGCGACGGGACG
GTGTCCAGCTTCATCGAGGTGCTGCAGAACATCCCGTCCCCGACCTTCAAGCTCCAGGACCTCATCAACAACTTCGCCAAGAAGGGCCTCAACGTCGACGACCTCGTCATTCTCTCCGGC
GCGCACTCCTTCGGCCAGGCGCACTGCTCCTTCTGCAACGGCCGGCTGTACCCTACCGTCGACCCCACCATGGACGGCACCTACGCCGCCGGGTTGAAGACGGTGTGCCCGGCGCCGGGC
AGCGGCGGCGGCGACCCGGTGATCGACAACAACCGGGTGACGGACCCCAACGTGCTCAGCAACCAGTACTACAGCAACCTGATGGCGGGGAAGGTGCTCTTCGTGTCGGACCAGCAGCTC
ATGAACACAAGCTACACGGCGGCCAAGGTGGCCAACAGCTCCGCTGACGCTGCCACGTGGATGAGCCAGTTCCAAACGGCGCTGGTGAAGATGGGCAGCATCCAGGTGCTCACCGGGACG
GCCGGCCAGGTCAGGAAGTACTGCAATGTCGTCAACAGCAGCTAA

Retrieve as FASTA