Entry information : SbPrx25 (Sobic.002G003400.1[2.1] / SB02G000490[1.4])
Entry ID 2716
Creation 2007-11-19 (Christophe Dunand)
Last sequence changes 2011-01-21 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx25 (Sobic.002G003400.1[2.1] / SB02G000490[1.4])
Name (synonym) SbPrx25 (Sobic.002G003400.1[2.1] / SB02G000490[1.4])
Class Class III peroxidase    [Orthogroup: Prx148]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx25
start..stop
S start..stop
ZmPrx21 577 0 18..344 10..339
SiPrx87 559 0 5..344 2..339
BdiPrx37 433 1e-153 42..344 27..330
OsPrx94 413 2e-145 41..344 45..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 446073..446333 261 N° 2 446445..447218 774  
join(446073..446333,446445..447218)


exon

Literature and cross-references SbPrx25 (Sobic.002G003400.1[2.1] / SB02G000490[1.4])
Literature Plant GDB.
DNA ref. Phytozome 12:   chromosome_2 (446073..447218)
Protein sequence: SbPrx25 (Sobic.002G003400.1[2.1] / SB02G000490[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (308)
PWM (Da):   %s   36061.11 (32653.3) Transmb domain:   %s   i20-42o
PI (pH):   %s   8.02 (7.67) Peptide Signal:   %s   cut: 37 range:37-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAAAATTATTRTAPRPMVAVAVLIVVLCATSVAGQGQLQLQVGYYNKTCPAAEQIVRNETTAAIQASPDLAAALLRLHYHDCFVQGCDASVLLDSTPNNTAEKDSLPNGSLRGFDVVARVKDQLETACPGTVSCADILALMARDAVSLAKGPTWPVALGRRDGRTSSAASCGELPPLHGDIGLMVQAFAAKGLDVKDLAVLSGAHTLGKAHCSSYADRLYASASCATPDPALDARYAARLRMRCPSAGDGNNATAASELDPGSCTTFDTSYYRHVARRRGLLRSDASLLDHRFTRAYVLQVASGRIDGHYFHDFTVSMAKMAAIGVLTGDQGEIRRKCNVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1). No EST. Cultivar="ATx623".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCAGCAGCGGCGACCACCGCCACCACCAGGACTGCACCTCGTCCCATGGTGGCCGTAGCAGTGCTAATAGTCGTCCTGTGTGCTACATCAGTTGCCGGGCAGGGGCAGCTC
CAGCTCCAGGTCGGCTACTACAACAAGACGTGCCCGGCGGCGGAGCAGATCGTGCGCAACGAGACGACGGCCGCCATCCAGGCCTCGCCGGACCTCGCCGCCGCGCTCCTCAGGCTGCAC
TACCACGACTGCTTCGTCCAG
GTACACCGTTGGCGTGGCATTGGGTACTACTGCTGGTCTGCTGTCATCATATATATATGCATCTCTTGCATGCGCTCATCACTGTGATCTGTGACTGCA
TCGATCTTTCAGGGGTGCGACGCGTCCGTGCTGCTGGACTCGACGCCCAACAACACGGCGGAGAAGGATTCGCTGCCCAACGGCAGCCTCCGCGGCTTCGACGTCGTGGCGCGGGTCAAG
GACCAGCTGGAGACGGCGTGCCCGGGCACCGTCTCCTGCGCGGACATCCTGGCGCTCATGGCGCGCGACGCCGTCTCGCTGGCCAAGGGCCCTACCTGGCCCGTCGCGCTGGGCCGCCGC
GACGGCCGCACCTCCAGCGCCGCCAGCTGCGGGGAGCTCCCGCCGCTGCACGGCGACATCGGGCTCATGGTGCAGGCGTTCGCCGCCAAGGGCCTCGACGTCAAGGACCTCGCCGTGCTG
TCGGGGGCGCACACGCTGGGGAAGGCGCACTGCTCGTCCTACGCCGACCGCCTCTACGCCTCCGCCAGCTGCGCCACGCCCGACCCGGCACTCGACGCGCGCTACGCCGCCAGGCTGCGG
ATGCGCTGCCCCAGCGCTGGCGACGGCAACAACGCTACGGCGGCGTCGGAGCTCGACCCCGGCAGCTGCACCACCTTCGACACCAGCTACTACCGCCACGTCGCGCGGAGGCGCGGCCTG
CTCCGCTCCGACGCCTCGCTGCTGGACCACCGCTTCACCAGGGCCTACGTGCTGCAGGTCGCCTCCGGCAGGATCGACGGCCACTACTTCCACGATTTCACCGTCTCCATGGCCAAGATG
GCGGCCATCGGTGTGCTCACCGGCGACCAGGGCGAGATCAGGAGAAAGTGCAACGTCGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCAGCAGCGGCGACCACCGCCACCACCAGGACTGCACCTCGTCCCATGGTGGCCGTAGCAGTGCTAATAGTCGTCCTGTGTGCTACATCAGTTGCCGGGCAGGGGCAGCTC
CAGCTCCAGGTCGGCTACTACAACAAGACGTGCCCGGCGGCGGAGCAGATCGTGCGCAACGAGACGACGGCCGCCATCCAGGCCTCGCCGGACCTCGCCGCCGCGCTCCTCAGGCTGCAC
TACCACGACTGCTTCGTCCAG
GGGTGCGACGCGTCCGTGCTGCTGGACTCGACGCCCAACAACACGGCGGAGAAGGATTCGCTGCCCAACGGCAGCCTCCGCGGCTTCGACGTCGTGGCG
CGGGTCAAGGACCAGCTGGAGACGGCGTGCCCGGGCACCGTCTCCTGCGCGGACATCCTGGCGCTCATGGCGCGCGACGCCGTCTCGCTGGCCAAGGGCCCTACCTGGCCCGTCGCGCTG
GGCCGCCGCGACGGCCGCACCTCCAGCGCCGCCAGCTGCGGGGAGCTCCCGCCGCTGCACGGCGACATCGGGCTCATGGTGCAGGCGTTCGCCGCCAAGGGCCTCGACGTCAAGGACCTC
GCCGTGCTGTCGGGGGCGCACACGCTGGGGAAGGCGCACTGCTCGTCCTACGCCGACCGCCTCTACGCCTCCGCCAGCTGCGCCACGCCCGACCCGGCACTCGACGCGCGCTACGCCGCC
AGGCTGCGGATGCGCTGCCCCAGCGCTGGCGACGGCAACAACGCTACGGCGGCGTCGGAGCTCGACCCCGGCAGCTGCACCACCTTCGACACCAGCTACTACCGCCACGTCGCGCGGAGG
CGCGGCCTGCTCCGCTCCGACGCCTCGCTGCTGGACCACCGCTTCACCAGGGCCTACGTGCTGCAGGTCGCCTCCGGCAGGATCGACGGCCACTACTTCCACGATTTCACCGTCTCCATG
GCCAAGATGGCGGCCATCGGTGTGCTCACCGGCGACCAGGGCGAGATCAGGAGAAAGTGCAACGTCGTCAACTGA

Retrieve as FASTA