Entry information : SbPrx17 (Sobic.001G379300.1[2.1] / SB01G035990[1.4])
Entry ID 2719
Creation 2006-02-22 (Christophe Dunand)
Last sequence changes 2006-02-22 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx17 (Sobic.001G379300.1[2.1] / SB01G035990[1.4])
Name (synonym) SbPrx17 (Sobic.001G379300.1[2.1] / SB01G035990[1.4])
Class Class III peroxidase    [Orthogroup: Prx172]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx17
start..stop
S start..stop
BdiPrx42 453 6e-162 29..318 34..321
SiPrx122 441 6e-157 10..318 27..338
HvPrx17 426 1e-151 1..318 1..312
OsPrx112 421 1e-149 29..318 28..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59657284..59657496 213 N° 2 59657578..59657769 192 N° 3 59657888..59658053 166 N° 4 59658173..59658558 386
join(59657284..59657496,59657578..59657769,59657888..59658053,59658173..59658558 )


exon

Literature and cross-references SbPrx17 (Sobic.001G379300.1[2.1] / SB01G035990[1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_1 (59657284..59658558)
Protein sequence: SbPrx17 (Sobic.001G379300.1[2.1] / SB01G035990[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   32773.36 (30523.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.71 (7.71) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASVSVQTIVLLLLAVAAVASAQLSATFYDSSCPRALGTIRSAVTAAVNRDPRMGASLLRLHFHDCFVQGCDASVLLSDRGSFTGEQNAFPNRGSLRGFDVVDSIKAQVEAVCPRTVSCADILAVAARDSVVTLGGPPYTVLLGRRDSTTASLSQANSDLPSPGSSLASLISGFARKGLTTTDMVALSGAHTVGQAQCTNFRSRLYGESNLNQSDAAALRANCPQSGGDGNLAPMDLATPNTFDAAFFRGLLSQRGVLHSDQQLFSGGSTDALVQSYASNAGQFRNDFAAAMVRMGSIGVLTGSQGQIRLSCSSVN

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (chromo 1, 3 introns). No EST. Incorrect prediction from phytozome (intron 3 is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCCTCAGTTTCCGTTCAGACGATCGTCCTCCTGCTCCTGGCCGTTGCCGCTGTGGCGTCGGCGCAGCTGTCGGCGACGTTCTACGACTCGTCCTGCCCGAGGGCGCTGGGC
ACCATCAGGAGCGCCGTGACGGCGGCGGTCAACAGGGACCCCCGCATGGGGGCCTCCCTGCTCAGGCTTCACTTCCACGACTGCTTCGTCCAG
GCAAGTCCTCGGTCGTCGTCGTCTCTG
CCGCTCGCTCGCTCGCTCAGCTCACGTACGTATTCCGTTCCGTGGCGTGCACAGGGATGCGATGCGTCGGTGCTGCTGTCCGACAGGGGCAGCTTCACAGGGGAGCAGAACGCGTTCCCC
AACCGGGGCTCGCTCAGGGGCTTCGACGTCGTCGACAGCATCAAGGCGCAGGTCGAGGCCGTCTGCCCGCGGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCGCGCGACTCCGTC
GTAACC
GTAAGATATCGATCGATCAAATAAACAAAATGCGCGTAGATTTTGACAGACAAGCAGCGGCGCTGACCGACACCGATGGTGGTTTATTCTATGCTTCCCTGTGTTTCGCTGCTT
GCAGTTAGGAGGGCCGCCGTACACGGTGCTCTTGGGGAGGAGGGACTCCACCACGGCGAGCCTCTCGCAGGCCAACAGCGACCTCCCTTCTCCGGGCTCCAGCCTCGCCAGCCTCATCAG
CGGCTTCGCCAGGAAGGGGCTCACCACCACTGACATGGTCGCGCTCTCAG
GTGCACGCTCTCGAACATGACGCGCATGCAATGCAATGCATGGCAACCCTTCACCTGGACGAGGGATGCT
GTGTCCTGCTGCACTCATTACTCATGTCAGTGGTTGGTCGTACGTGCAGGAGCTCACACGGTCGGGCAGGCGCAGTGCACCAACTTCCGGAGCCGGCTCTACGGCGAGTCCAACCTCAAC
CAGTCGGACGCGGCGGCGCTCAGGGCCAACTGCCCGCAGTCAGGCGGCGACGGCAACCTTGCGCCCATGGACCTGGCGACGCCCAACACGTTCGACGCCGCCTTCTTCCGCGGCCTGCTC
TCGCAGCGCGGGGTGCTGCACTCCGACCAGCAGCTCTTCAGCGGGGGCTCCACCGACGCGCTGGTGCAGAGCTACGCGTCCAACGCGGGGCAGTTCAGAAACGACTTCGCCGCGGCCATG
GTCCGCATGGGCAGCATCGGCGTGCTCACCGGCTCGCAGGGCCAGATCAGGCTCAGTTGCTCCAGCGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCCTCAGTTTCCGTTCAGACGATCGTCCTCCTGCTCCTGGCCGTTGCCGCTGTGGCGTCGGCGCAGCTGTCGGCGACGTTCTACGACTCGTCCTGCCCGAGGGCGCTGGGC
ACCATCAGGAGCGCCGTGACGGCGGCGGTCAACAGGGACCCCCGCATGGGGGCCTCCCTGCTCAGGCTTCACTTCCACGACTGCTTCGTCCAG
GGATGCGATGCGTCGGTGCTGCTGTCC
GACAGGGGCAGCTTCACAGGGGAGCAGAACGCGTTCCCCAACCGGGGCTCGCTCAGGGGCTTCGACGTCGTCGACAGCATCAAGGCGCAGGTCGAGGCCGTCTGCCCGCGGACCGTCTCC
TGCGCCGACATCCTCGCCGTCGCCGCGCGCGACTCCGTCGTAACC
TTAGGAGGGCCGCCGTACACGGTGCTCTTGGGGAGGAGGGACTCCACCACGGCGAGCCTCTCGCAGGCCAACAGC
GACCTCCCTTCTCCGGGCTCCAGCCTCGCCAGCCTCATCAGCGGCTTCGCCAGGAAGGGGCTCACCACCACTGACATGGTCGCGCTCTCAG
GAGCTCACACGGTCGGGCAGGCGCAGTGC
ACCAACTTCCGGAGCCGGCTCTACGGCGAGTCCAACCTCAACCAGTCGGACGCGGCGGCGCTCAGGGCCAACTGCCCGCAGTCAGGCGGCGACGGCAACCTTGCGCCCATGGACCTGGCG
ACGCCCAACACGTTCGACGCCGCCTTCTTCCGCGGCCTGCTCTCGCAGCGCGGGGTGCTGCACTCCGACCAGCAGCTCTTCAGCGGGGGCTCCACCGACGCGCTGGTGCAGAGCTACGCG
TCCAACGCGGGGCAGTTCAGAAACGACTTCGCCGCGGCCATGGTCCGCATGGGCAGCATCGGCGTGCTCACCGGCTCGCAGGGCCAGATCAGGCTCAGTTGCTCCAGCGTCAACTGA

Retrieve as FASTA