Entry information : SbPrx109 (Sobic.009G032700.1 [2.1] / SB09G002750 [1.4])
Entry ID 2722
Creation 2006-01-13 (Christophe Dunand)
Last sequence changes 2006-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx109 (Sobic.009G032700.1 [2.1] / SB09G002750 [1.4])
Name (synonym) SbPrx109 (Sobic.009G032700.1 [2.1] / SB09G002750 [1.4])
Class Class III peroxidase    [Orthogroup: Prx127]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx109
start..stop
S start..stop
SbPrx111 655 0 1..323 1..323
ZmPrx129 505 0 1..323 1..327
SiPrx104 482 2e-173 21..323 22..323
SiPrx99 468 4e-168 1..323 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2993428..2993646 219 N° 2 2992520..2993272 753  
complement(join(2992520..2993272,2993428..2993646))


exon

Literature and cross-references SbPrx109 (Sobic.009G032700.1 [2.1] / SB09G002750 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_9 (2993646..2992520)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.377.1
Protein sequence: SbPrx109 (Sobic.009G032700.1 [2.1] / SB09G002750 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (304)
PWM (Da):   %s   33927.5 (32076.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.72 (6.73) Peptide Signal:   %s   cut: 20 range:20-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPTCQALVIILIAVAAAMSTASGTALQYDFYKSSCPKAEEAVRNATQKIISNDPTMAAAFVRLFFHDCFVRGCDASILLDQSNSNSQPEKLAIPLRGYAEVNMIKGAVEAECQGVVSCADILAYAARDSAILSGGFGFAMPGGRRDGFVSNSNNIFGNLPAPNMQVQDLITSFNNKGLSSTDLVALSGAHSFGQTHCSFVTPRLYPTVDTTMNGSFAQGLMAVCPSQGGGGTVLNNNRVTDPNRLSNQYYTNLATGQVMFTSDQTLTSNATTNKMVQDNAADPVAWMARFAAAMVKMGGIQVLTGNQGEIRRVCGATNSGN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCCCAACGTGCCAGGCCTTAGTGATCATCCTGATCGCTGTAGCTGCTGCAATGAGCACGGCGTCTGGTACAGCATTGCAGTACGACTTCTACAAGTCGTCGTGCCCAAAAGCC
GAGGAGGCTGTCCGCAACGCCACTCAGAAGATCATCTCCAACGACCCCACCATGGCTGCCGCCTTTGTGCGTCTCTTCTTCCATGACTGCTTCGTCAGG
GTAACGATCTCAGCTTGTCCT
CCTTAATTTGTGACATATACTTTTATATGAAATTGTGAGTAACAATGAAATGTCGAAAACGATGTATAGTTTATATATGTAACAGCACTACAAGCTCAGTAATTGACCACAGATGAATTG
ATTTCTCGTTTCAGGGTTGTGACGCTTCCATTCTGCTCGACCAGTCCAATAGCAACTCACAGCCTGAGAAGTTAGCCATCCCGCTACGTGGTTACGCCGAAGTGAACATGATCAAGGGGG
CCGTGGAGGCCGAGTGCCAAGGCGTCGTCTCCTGTGCCGACATCCTCGCCTACGCGGCGCGCGACTCCGCCATCCTCTCCGGCGGCTTCGGCTTCGCCATGCCCGGCGGCCGGCGCGACG
GATTCGTGTCCAACTCGAACAACATTTTTGGGAACCTCCCTGCCCCCAACATGCAGGTCCAGGACCTCATCACAAGCTTCAACAACAAGGGCCTCAGCTCCACTGACCTGGTGGCGCTCT
CCGGCGCACACTCCTTTGGCCAAACGCACTGCTCCTTCGTCACGCCCCGGCTGTACCCCACCGTGGACACGACCATGAACGGCAGCTTCGCCCAAGGGCTCATGGCAGTGTGCCCATCGC
AAGGCGGTGGCGGCACCGTGCTGAACAACAACCGTGTGACAGATCCCAACAGGCTGAGCAACCAGTATTACACCAACTTGGCCACCGGGCAGGTGATGTTCACGTCGGACCAGACGCTGA
CGAGCAACGCCACCACCAACAAGATGGTGCAGGACAATGCTGCCGACCCGGTCGCATGGATGGCACGGTTCGCGGCGGCGATGGTGAAGATGGGAGGTATCCAGGTGCTCACCGGCAACC
AGGGTGAGATCAGGAGAGTCTGTGGCGCCACCAACAGTGGTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCCCAACGTGCCAGGCCTTAGTGATCATCCTGATCGCTGTAGCTGCTGCAATGAGCACGGCGTCTGGTACAGCATTGCAGTACGACTTCTACAAGTCGTCGTGCCCAAAAGCC
GAGGAGGCTGTCCGCAACGCCACTCAGAAGATCATCTCCAACGACCCCACCATGGCTGCCGCCTTTGTGCGTCTCTTCTTCCATGACTGCTTCGTCAGG
GGTTGTGACGCTTCCATTCTG
CTCGACCAGTCCAATAGCAACTCACAGCCTGAGAAGTTAGCCATCCCGCTACGTGGTTACGCCGAAGTGAACATGATCAAGGGGGCCGTGGAGGCCGAGTGCCAAGGCGTCGTCTCCTGT
GCCGACATCCTCGCCTACGCGGCGCGCGACTCCGCCATCCTCTCCGGCGGCTTCGGCTTCGCCATGCCCGGCGGCCGGCGCGACGGATTCGTGTCCAACTCGAACAACATTTTTGGGAAC
CTCCCTGCCCCCAACATGCAGGTCCAGGACCTCATCACAAGCTTCAACAACAAGGGCCTCAGCTCCACTGACCTGGTGGCGCTCTCCGGCGCACACTCCTTTGGCCAAACGCACTGCTCC
TTCGTCACGCCCCGGCTGTACCCCACCGTGGACACGACCATGAACGGCAGCTTCGCCCAAGGGCTCATGGCAGTGTGCCCATCGCAAGGCGGTGGCGGCACCGTGCTGAACAACAACCGT
GTGACAGATCCCAACAGGCTGAGCAACCAGTATTACACCAACTTGGCCACCGGGCAGGTGATGTTCACGTCGGACCAGACGCTGACGAGCAACGCCACCACCAACAAGATGGTGCAGGAC
AATGCTGCCGACCCGGTCGCATGGATGGCACGGTTCGCGGCGGCGATGGTGAAGATGGGAGGTATCCAGGTGCTCACCGGCAACCAGGGTGAGATCAGGAGAGTCTGTGGCGCCACCAAC
AGTGGTAACTGA

Retrieve as FASTA