Entry information : SbPrx111 (Sobic.009G032900.1 [2.1] / SB09G002770 [1.4])
Entry ID 2724
Creation 2006-01-13 (Christophe Dunand)
Last sequence changes 2006-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx111 (Sobic.009G032900.1 [2.1] / SB09G002770 [1.4])
Name (synonym) SbPrx111 (Sobic.009G032900.1 [2.1] / SB09G002770 [1.4])
Class Class III peroxidase    [Orthogroup: Prx127]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx111
start..stop
S start..stop
SbPrx109 655 0 1..323 1..323
ZmPrx129 509 0 2..323 3..327
SiPrx104 486 7e-175 1..323 1..323
SiPrx99 478 1e-171 1..323 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3010745..3010963 219 N° 2 3011154..3011906 753  
join(3010745..3010963,3011154..3011906)


exon

Literature and cross-references SbPrx111 (Sobic.009G032900.1 [2.1] / SB09G002770 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_9 (3010745..3011906)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.1482.1
Protein sequence: SbPrx111 (Sobic.009G032900.1 [2.1] / SB09G002770 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   33944.55 (31713.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.22 (7.24) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSTCQALVIILIAVAAAMSTASGTALQYDFYKSSCPKAEEAVRNATQKIISNDPTMAAAFVRLFFHDCFVRGCDASILLDQSNSNSQPEKLAIPLRGYAEVNMIKAAVEAECQGVVSCADILAYAARDSAILSGGFGFAMPGGRRDGFVSNSNNIFGNLPGPNMQVQDLITSFNNKGLSSTDLVALSGAHSFGQTHCSFVTPRLYPTVDTTMNGSFAQGLKTVCPSQGGGGTVLNNNRVTDPNRLSNQYYTNLATGQVMFTSDQTLTSNATTNKMVQDNAADPVAWMARFAAAMVKMGGIQVLTGNQGEIRRVCGATNSGN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, intron 1). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCTCAACGTGCCAGGCCTTAGTGATCATCCTGATCGCTGTAGCTGCTGCAATGAGCACGGCGTCTGGTACAGCATTGCAGTACGACTTCTACAAGTCGTCGTGCCCAAAAGCC
GAGGAGGCTGTCCGCAACGCCACTCAGAAGATCATCTCCAACGACCCCACCATGGCTGCCGCCTTTGTGCGCCTCTTCTTCCATGACTGCTTCGTCAGG
GTAACGATCTCAGCTTGTCCT
CCATAATTTGTGACATATACTTTTATATGAAACTGTGAGTAACAATGCCTGGTTACAACAAAATGTCAAACACAATGTACAGTTTATATATGTTATAGCACTACAAGCACTCATGTGTAA
TCATGTGTAAGTAATAATTGACAACAGATGAATTGATTTCTCGTTTCAGGGTTGTGACGCTTCCATTCTGCTCGACCAATCCAATAGCAACTCACAGCCTGAGAAGTTAGCCATCCCGCT
ACGTGGTTACGCTGAAGTGAACATGATCAAGGCGGCCGTGGAGGCCGAGTGCCAAGGCGTCGTCTCCTGCGCCGACATCCTCGCCTATGCGGCGCGCGACTCCGCCATCCTCTCCGGCGG
CTTCGGCTTCGCCATGCCCGGTGGCCGGCGCGACGGATTCGTGTCCAACTCGAACAACATTTTTGGGAACCTCCCTGGACCCAACATGCAGGTCCAGGACCTCATCACGAGCTTCAACAA
CAAGGGCCTCAGCTCCACTGACCTGGTGGCGCTCTCCGGCGCACACTCCTTTGGCCAAACGCACTGCTCCTTCGTTACGCCCCGGCTGTACCCCACCGTGGACACGACCATGAACGGCAG
CTTCGCCCAAGGGCTAAAGACAGTGTGCCCATCGCAAGGCGGTGGTGGCACCGTGCTGAACAACAACCGTGTGACAGACCCCAACAGGCTGAGCAACCAGTATTACACCAACTTGGCCAC
CGGGCAGGTGATGTTCACGTCGGACCAGACGCTGACGAGCAATGCCACCACCAACAAGATGGTGCAGGACAATGCTGCCGACCCGGTCGCATGGATGGCACGGTTCGCGGCGGCGATGGT
CAAGATGGGAGGTATCCAGGTGCTCACCGGCAACCAGGGTGAGATCAGGAGAGTCTGCGGCGCCACCAACAGTGGTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCTCAACGTGCCAGGCCTTAGTGATCATCCTGATCGCTGTAGCTGCTGCAATGAGCACGGCGTCTGGTACAGCATTGCAGTACGACTTCTACAAGTCGTCGTGCCCAAAAGCC
GAGGAGGCTGTCCGCAACGCCACTCAGAAGATCATCTCCAACGACCCCACCATGGCTGCCGCCTTTGTGCGCCTCTTCTTCCATGACTGCTTCGTCAGG
GGTTGTGACGCTTCCATTCTG
CTCGACCAATCCAATAGCAACTCACAGCCTGAGAAGTTAGCCATCCCGCTACGTGGTTACGCTGAAGTGAACATGATCAAGGCGGCCGTGGAGGCCGAGTGCCAAGGCGTCGTCTCCTGC
GCCGACATCCTCGCCTATGCGGCGCGCGACTCCGCCATCCTCTCCGGCGGCTTCGGCTTCGCCATGCCCGGTGGCCGGCGCGACGGATTCGTGTCCAACTCGAACAACATTTTTGGGAAC
CTCCCTGGACCCAACATGCAGGTCCAGGACCTCATCACGAGCTTCAACAACAAGGGCCTCAGCTCCACTGACCTGGTGGCGCTCTCCGGCGCACACTCCTTTGGCCAAACGCACTGCTCC
TTCGTTACGCCCCGGCTGTACCCCACCGTGGACACGACCATGAACGGCAGCTTCGCCCAAGGGCTAAAGACAGTGTGCCCATCGCAAGGCGGTGGTGGCACCGTGCTGAACAACAACCGT
GTGACAGACCCCAACAGGCTGAGCAACCAGTATTACACCAACTTGGCCACCGGGCAGGTGATGTTCACGTCGGACCAGACGCTGACGAGCAATGCCACCACCAACAAGATGGTGCAGGAC
AATGCTGCCGACCCGGTCGCATGGATGGCACGGTTCGCGGCGGCGATGGTCAAGATGGGAGGTATCCAGGTGCTCACCGGCAACCAGGGTGAGATCAGGAGAGTCTGCGGCGCCACCAAC
AGTGGTAACTGA

Retrieve as FASTA