Entry information : SbPrx49 (Sobic.002G416900.1 [2.1] / SB02G042880 [1.4])
Entry ID 2730
Creation 2006-01-13 (Christophe Dunand)
Last sequence changes 2006-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx49 (Sobic.002G416900.1 [2.1] / SB02G042880 [1.4])
Name (synonym) SbPrx49 (Sobic.002G416900.1 [2.1] / SB02G042880 [1.4])
Class Class III peroxidase    [Orthogroup: Prx082]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx49
start..stop
S start..stop
ZmPrx56 557 0 1..323 1..323
SiPrx127 520 0 27..323 24..321
OsPrx115 479 4e-172 27..323 23..321
BdiPrx04 465 1e-166 7..322 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76607294..76607512 219 N° 2 76606991..76607185 195 N° 3 76606300..76606860 561  
complement(join(76606300..76606860,76606991..76607185,76607294..76607512))


exon

Literature and cross-references SbPrx49 (Sobic.002G416900.1 [2.1] / SB02G042880 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_2 (76607512..76606300)
Protein sequence: SbPrx49 (Sobic.002G416900.1 [2.1] / SB02G042880 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (298)
PWM (Da):   %s   34418.95 (31801.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   4.22 (4.13) Peptide Signal:   %s   cut: 27 range:27-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSRMGALLVVYLTLMAAALGVRAELTADYYSETCPLALSTIKVLVGTAIVGEPRMGASLVRLHFHDCFVNGCDGSILLDDTDDMVGEKTAKPNNNSVRGYEVIDTIKSAVNTVCLGNVVSCADILAVAARDSIVALGGTSYDVVLGRRDATTASMDDANNVIPNPFMDLPALQASFESLGLSLHDLVVLSGGHTLGYARCLFFRGRLYNETATLDPTYAASLDERCPLSGDDDALSALDDTPTTVDTDYYQGLIQGRALLHTDQQLYQGGGDAGDLVKYYADNPTKFWEDFGAAMVKLGNLSPLTGDQGEVRENCRVVNQA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCGTCGCGAATGGGCGCGCTACTAGTTGTCTACCTCACTCTCATGGCGGCGGCTCTCGGGGTCAGGGCGGAGCTCACCGCGGACTACTACAGCGAGACGTGCCCGCTCGCG
CTGAGCACCATCAAGGTCCTCGTCGGCACCGCCATCGTGGGGGAGCCCAGGATGGGGGCGTCGCTGGTCCGCCTACACTTCCACGACTGCTTCGTCAAT
GTGAGCGAGCTTCTTCTTCTA
CCTAGCTGATGATCAAGCCACGCACACCGCCGCCGCCATGCAATGCAAGCCAGCCATGTAACTGTAATTAACCTATACGCATTGCAGGGCTGCGACGGCTCCATCCTGCTGGACGACACC
GACGACATGGTCGGCGAGAAGACGGCCAAGCCCAACAACAACTCCGTGAGAGGCTACGAGGTCATCGACACCATCAAGTCGGCGGTGAACACGGTATGCTTGGGGAACGTCGTCTCCTGC
GCCGATATCTTGGCTGTGGCCGCTCGCGATTCCATTGTCGCT
GTAAGTTCTGTTACTTAAATCTTCACTCTGAAGTGACGACACTGACAGTATGGCACTGACACTGACAGTTTTTCATTT
TTTTTTTGTCTGTGCGCGCCTACGTACTGTGAATGTCCGTTTCTACAATTAGCTGGGAGGAACCTCGTACGACGTGGTCCTCGGGCGGCGCGACGCGACGACGGCGAGCATGGACGACGC
GAACAACGTGATCCCGAACCCGTTCATGGACCTGCCGGCGCTGCAGGCGAGCTTCGAGTCCCTGGGCCTGTCCCTGCACGACCTGGTGGTGCTCTCCGGCGGCCACACGCTGGGCTACGC
CCGCTGCCTCTTCTTCCGGGGCCGCCTGTACAACGAGACGGCGACGCTGGACCCGACCTACGCGGCGTCGCTGGACGAGCGGTGCCCGCTGTCGGGCGACGACGACGCGCTGTCGGCGCT
GGACGACACCCCGACCACCGTCGACACGGACTACTACCAGGGCCTCATTCAGGGCCGCGCGCTGCTGCACACGGACCAGCAGCTGTACCAGGGCGGCGGCGACGCCGGCGACCTGGTCAA
GTACTACGCCGACAACCCCACCAAGTTCTGGGAGGACTTCGGCGCGGCCATGGTGAAGCTGGGCAACCTAAGCCCGCTCACCGGCGACCAAGGAGAGGTCAGGGAGAACTGCCGGGTCGT
CAACCAGGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCGTCGCGAATGGGCGCGCTACTAGTTGTCTACCTCACTCTCATGGCGGCGGCTCTCGGGGTCAGGGCGGAGCTCACCGCGGACTACTACAGCGAGACGTGCCCGCTCGCG
CTGAGCACCATCAAGGTCCTCGTCGGCACCGCCATCGTGGGGGAGCCCAGGATGGGGGCGTCGCTGGTCCGCCTACACTTCCACGACTGCTTCGTCAAT
GGCTGCGACGGCTCCATCCTG
CTGGACGACACCGACGACATGGTCGGCGAGAAGACGGCCAAGCCCAACAACAACTCCGTGAGAGGCTACGAGGTCATCGACACCATCAAGTCGGCGGTGAACACGGTATGCTTGGGGAAC
GTCGTCTCCTGCGCCGATATCTTGGCTGTGGCCGCTCGCGATTCCATTGTCGCT
CTGGGAGGAACCTCGTACGACGTGGTCCTCGGGCGGCGCGACGCGACGACGGCGAGCATGGACGAC
GCGAACAACGTGATCCCGAACCCGTTCATGGACCTGCCGGCGCTGCAGGCGAGCTTCGAGTCCCTGGGCCTGTCCCTGCACGACCTGGTGGTGCTCTCCGGCGGCCACACGCTGGGCTAC
GCCCGCTGCCTCTTCTTCCGGGGCCGCCTGTACAACGAGACGGCGACGCTGGACCCGACCTACGCGGCGTCGCTGGACGAGCGGTGCCCGCTGTCGGGCGACGACGACGCGCTGTCGGCG
CTGGACGACACCCCGACCACCGTCGACACGGACTACTACCAGGGCCTCATTCAGGGCCGCGCGCTGCTGCACACGGACCAGCAGCTGTACCAGGGCGGCGGCGACGCCGGCGACCTGGTC
AAGTACTACGCCGACAACCCCACCAAGTTCTGGGAGGACTTCGGCGCGGCCATGGTGAAGCTGGGCAACCTAAGCCCGCTCACCGGCGACCAAGGAGAGGTCAGGGAGAACTGCCGGGTC
GTCAACCAGGCGTGA

Retrieve as FASTA