Entry information : SbPrx09 (Sobic.001G293000.1[2.1] / Sb01g028610[1.4])
Entry ID 2731
Creation 2008-10-13 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx09 (Sobic.001G293000.1[2.1] / Sb01g028610[1.4])
Name (synonym) SbPrx09 (Sobic.001G293000.1[2.1] / Sb01g028610[1.4])
Class Class III peroxidase    [Orthogroup: Prx120]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx09
start..stop
S start..stop
ZmPrx126 554 0 28..331 14..317
SiPrx158 517 0 1..331 1..329
SbPrx11 516 0 26..331 25..330
SiPrx156 512 0 28..331 28..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49904947..49905180 234 N° 2 49903885..49904646 762  
complement(join(49903885..49904646,49904947..49905180))


exon

Literature and cross-references SbPrx09 (Sobic.001G293000.1[2.1] / Sb01g028610[1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_1 (49905138..49903885)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.51676.1
Protein sequence: SbPrx09 (Sobic.001G293000.1[2.1] / Sb01g028610[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (302)
PWM (Da):   %s   35301.13 (32807.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.14 (9.14) Peptide Signal:   %s   cut: 30 range:30-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAAPNGAAAAALMVAVSILALAAGASAQLQYGFYKGKCNGNDVEAVVQGIVRARFARENPIVAYLLRMQFHECAVNGCDGGLLIDGPGTEKTAPPNFSVKGYDVIAAIKAELERRCPGVVSCSDIQILATRDAVALAGGASYAVRTGRRDRRRSLASDVKLPSPEFTAAQTVAYYGSLGLSPFDAVLLLGAHTVGATRCSAIKSSRLYRYGGRAGATDPGMDPGYAFLYKNNVCPNVPSSDNNVVFLDDQWSALKLDNHYYKNLQRKRGVLSVDQNLYKDGSTSWIVDLLAKDNGLFAWLFPKALVKLSEVNVLTGTQGEIRKVCNRFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAGCGCCCAATGGTGCGGCCGCGGCGGCGCTCATGGTGGCCGTCTCCATCCTGGCACTTGCCGCCGGCGCCAGCGCCCAGCTGCAGTACGGCTTCTACAAGGGCAAGTGC
AACGGCAACGACGTGGAGGCGGTGGTCCAGGGCATCGTCAGGGCCCGCTTCGCGCGCGAGAACCCCATCGTCGCCTACCTCCTCCGCATGCAGTTCCACGAGTGCGCCGTCAAT
GTACGT
GCGTGCACAAGCTAAGCCACGCGTGTGTTGCATACTTGCATTGGTTTCTTATATATAATATGGTCTTGTGTAGTTCACCCTGAAAACCAAAAAGTTTTCAAGATTCTCCGTCACATCGAA
TCTTGTGGCACATGCATGAAACATTAAATATAGACGAAAACAAAAACTAATTACACAGTTTAGCTGTAAATCACGAGACGAATCTTTTGATCCTAGTTGTGCTAGAGTACTGACAACTTT
TCACTTTTCGAAACTAAACAAGGCCTATATATATATATAAATAATTGCATGCAGGGCTGCGACGGCGGCCTGCTGATCGACGGCCCCGGCACCGAGAAGACGGCGCCGCCGAACTTTAGC
GTCAAGGGCTACGACGTAATCGCGGCCATCAAGGCGGAGCTGGAGCGGAGGTGCCCCGGCGTGGTGTCCTGCTCCGACATCCAGATCCTCGCCACCAGGGACGCCGTCGCGCTGGCCGGC
GGGGCGTCGTACGCGGTGCGCACGGGGCGGAGGGACCGCCGGCGGTCACTGGCCTCCGACGTCAAGCTGCCGTCGCCCGAGTTCACCGCGGCGCAGACGGTCGCGTACTACGGCAGCCTG
GGGCTGAGCCCGTTCGACGCGGTGCTGCTGCTGGGCGCGCACACCGTGGGCGCCACGCGCTGCAGCGCCATCAAGAGCAGCCGGCTGTACAGGTACGGCGGCAGGGCCGGCGCGACGGAC
CCCGGCATGGACCCGGGCTACGCGTTCTTGTACAAGAACAACGTGTGCCCCAACGTGCCGTCGTCGGACAACAACGTCGTGTTCCTGGACGACCAGTGGAGCGCGCTCAAGCTGGACAAC
CACTACTACAAGAACCTGCAGAGAAAACGCGGCGTGCTCTCCGTCGACCAGAACCTGTACAAGGACGGGTCCACGAGCTGGATCGTGGACCTGCTCGCCAAAGACAACGGCCTCTTCGCT
TGGCTTTTCCCCAAGGCGCTCGTCAAGCTCAGCGAGGTCAACGTGCTCACCGGCACGCAGGGGGAGATCCGCAAGGTCTGCAACAGGTTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAGCGCCCAATGGTGCGGCCGCGGCGGCGCTCATGGTGGCCGTCTCCATCCTGGCACTTGCCGCCGGCGCCAGCGCCCAGCTGCAGTACGGCTTCTACAAGGGCAAGTGC
AACGGCAACGACGTGGAGGCGGTGGTCCAGGGCATCGTCAGGGCCCGCTTCGCGCGCGAGAACCCCATCGTCGCCTACCTCCTCCGCATGCAGTTCCACGAGTGCGCCGTCAAT
GGCTGC
GACGGCGGCCTGCTGATCGACGGCCCCGGCACCGAGAAGACGGCGCCGCCGAACTTTAGCGTCAAGGGCTACGACGTAATCGCGGCCATCAAGGCGGAGCTGGAGCGGAGGTGCCCCGGC
GTGGTGTCCTGCTCCGACATCCAGATCCTCGCCACCAGGGACGCCGTCGCGCTGGCCGGCGGGGCGTCGTACGCGGTGCGCACGGGGCGGAGGGACCGCCGGCGGTCACTGGCCTCCGAC
GTCAAGCTGCCGTCGCCCGAGTTCACCGCGGCGCAGACGGTCGCGTACTACGGCAGCCTGGGGCTGAGCCCGTTCGACGCGGTGCTGCTGCTGGGCGCGCACACCGTGGGCGCCACGCGC
TGCAGCGCCATCAAGAGCAGCCGGCTGTACAGGTACGGCGGCAGGGCCGGCGCGACGGACCCCGGCATGGACCCGGGCTACGCGTTCTTGTACAAGAACAACGTGTGCCCCAACGTGCCG
TCGTCGGACAACAACGTCGTGTTCCTGGACGACCAGTGGAGCGCGCTCAAGCTGGACAACCACTACTACAAGAACCTGCAGAGAAAACGCGGCGTGCTCTCCGTCGACCAGAACCTGTAC
AAGGACGGGTCCACGAGCTGGATCGTGGACCTGCTCGCCAAAGACAACGGCCTCTTCGCTTGGCTTTTCCCCAAGGCGCTCGTCAAGCTCAGCGAGGTCAACGTGCTCACCGGCACGCAG
GGGGAGATCCGCAAGGTCTGCAACAGGTTCAACTGA

Retrieve as FASTA