Entry information : SbPrx94 ( Sobic.006G224500.1 [2.1] / SB06G029370 [1.4])
Entry ID 2735
Creation 2006-01-13 (Christophe Dunand)
Last sequence changes 2006-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx94 ( Sobic.006G224500.1 [2.1] / SB06G029370 [1.4])
Name (synonym) SbPrx94 ( Sobic.006G224500.1 [2.1] / SB06G029370 [1.4])
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx94
start..stop
S start..stop
SiPrx50 613 0 4..347 1..347
ZmPrx140 602 0 4..347 1..352
OsPrx56 546 0 4..347 1..328
BdiPrx132 535 0 4..347 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58008763..58009020 258 N° 2 58009141..58009332 192 N° 3 58009565..58009733 169 N° 4 58010305..58010729 425
join(58008763..58009020,58009141..58009332,58009565..58009733,58010305..58010729 )


exon

Literature and cross-references SbPrx94 ( Sobic.006G224500.1 [2.1] / SB06G029370 [1.4])
Literature Plant Genome database
DNA ref. Phytozome 12:   chromosome_6 (58008763..58010729)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.2512.1
Protein sequence: SbPrx94 ( Sobic.006G224500.1 [2.1] / SB06G029370 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (323)
PWM (Da):   %s   37669.15 (34995.8)  
PI (pH):   %s   8.56 (8.39) Peptide Signal:   %s   cut: 25 range:25-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSMGFRLLFGFVIPLFLQFSSSAQSNPLQLGLQQPSPSGLRVGFYQYTCPNAEAIVRDEMTKIISQVPSLAGPLLRLHFHDCFVNGCDGSVLLNSSIPGVPTEKEAIPNLTLRGFGTIDRVKAKLERACPGVVSCADILALVARDVVVLTKGPHWDVPTGRRDGRISVKQDALNNLPAPFFDAGRNLFQFFIPKGLDAKDQIVLLGGHTLGTSHCSSFADRLYNFSGTMTADPSLDKRYLPRLKSKCSNPGDTTTLVEMDPGSFRTFDASYYRHVARGRSLFFSDQTLMNDAFARAYVQRQAAVADAGAYPAEFFADFAASMVKMGGVQVLTGAQGEVRRHCALVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAGCATGGGTTTCAGGCTTCTCTTCGGATTTGTCATTCCTCTCTTCCTACAATTCTCATCATCAGCGCAATCCAATCCATTACAACTAGGGCTACAACAACCCTCTCCATCAGGG
CTGAGGGTTGGTTTTTACCAGTACACGTGTCCGAATGCAGAGGCCATTGTTCGCGACGAAATGACCAAGATCATCTCCCAAGTCCCAAGCCTCGCTGGGCCTCTGCTCCGGCTGCACTTC
CATGACTGCTTTGTCAAT
GTAAGCGTGATCGTCATGCATTTTGGTTTGTTCTGAACTGCTTCAGCTGAGTTCAGTAGTTATATATGCATGTGACTCAAGGATTATACTGAATGTGCAGTG
TGCTATGCTATGCTGCAGGGCTGTGATGGTTCTGTTCTTCTGAATAGCAGCATACCGGGAGTACCAACCGAGAAGGAAGCAATTCCGAACCTCACCTTGCGAGGCTTTGGCACGATCGAC
CGTGTGAAGGCGAAGCTGGAGCGGGCCTGCCCTGGAGTGGTGTCCTGTGCTGATATCTTGGCTCTGGTAGCAAGGGACGTTGTTGTACTG
GTAAGAAATCCTTATTCTTCAGATAAGTAA
ACATATGTATGGTTAAAATTTCCCTAATTGGCTGGTTGGCAACGATGAGTGGCCATAAAATGGCAGTGGCTATAAGTTAGTTTTAGCATCTTTATCTGATGACTTGCCAGTGTTGGCTCT
CTTGCTGCTGAAAGTTACTGAATTGCTGAACGACTATAGTTAAACCCTGGGTTCTTTCTTTTTACTGTTTGCTATGCAACAGACCAAAGGGCCTCATTGGGATGTTCCAACCGGGCGGAG
AGACGGAAGAATATCAGTGAAGCAAGATGCTCTGAACAACCTCCCTGCGCCCTTCTTTGATGCTGGTCGGAACCTGTTCCAGTTCTTCATCCCCAAGGGCCTCGATGCCAAGGATCAGAT
TGTTCTGCTAG
GTAAAATATAAAATTTATTCAGGAGCTAAATTCGATGCCTTATCTTTAGTTAAAAAAAATGCATGGCACCCGGATGCATGATTGGTACTGCTGGCTCTCGCCTGGTTCT
TCGTTCTTGTAGCCCATGGTTCTTTAAAAATCTGCGGCAGCAACATTCCCCGATAAAGGTGACCATTTGTAGTTTAACTACGAAGCAACTTGTGTTAGTGAAAGAAGTCAGCTGAGTTGG
GAAAAAACGAGACTATATGGTTCTTAGTCTAATCACATGACGTCACACAGAATAATCCAGGGATAATTAAACACAACCCGTACCCTGAGTTCAGGCTTCCCTGCTGTTTTCTTCTTTTTT
CTGTTTTGCTTTAGTTTTTGCTTCTTCCTTTGTCTTGTTTGTTGTAAAACTTTTACCTCTTTTGAATAAATTCCTGTAGAAGCATTTGGCCTCTCCAGTTCACTCAAAAAAAAATTAAAC
ACAACCCAGTTCATCATTTTCAAAAACAAATATGCACTTTCTTGCTCCTGCCATTATATACAATTTGTTTCGAATATGAACTTCCCTTGCATATGCATGCAGGAGGGCACACTCTGGGTA
CCTCGCACTGCTCGTCGTTCGCGGACCGGCTGTACAACTTCAGCGGCACGATGACGGCGGACCCGTCGCTGGACAAGCGGTACCTGCCGCGGCTGAAGAGCAAATGCAGCAACCCCGGCG
ACACGACGACGCTGGTGGAGATGGACCCCGGCAGCTTCCGCACGTTCGACGCGAGCTACTACCGGCACGTCGCCAGAGGCCGGTCGCTCTTCTTCTCCGACCAGACGCTCATGAACGACG
CCTTCGCCAGGGCCTACGTCCAGCGCCAGGCCGCCGTGGCCGACGCCGGCGCCTACCCCGCCGAGTTCTTCGCCGACTTCGCCGCGTCCATGGTCAAGATGGGCGGCGTGCAGGTGCTCA
CCGGCGCGCAGGGGGAGGTCCGGAGGCACTGCGCCCTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAGCATGGGTTTCAGGCTTCTCTTCGGATTTGTCATTCCTCTCTTCCTACAATTCTCATCATCAGCGCAATCCAATCCATTACAACTAGGGCTACAACAACCCTCTCCATCAGGG
CTGAGGGTTGGTTTTTACCAGTACACGTGTCCGAATGCAGAGGCCATTGTTCGCGACGAAATGACCAAGATCATCTCCCAAGTCCCAAGCCTCGCTGGGCCTCTGCTCCGGCTGCACTTC
CATGACTGCTTTGTCAAT
GGCTGTGATGGTTCTGTTCTTCTGAATAGCAGCATACCGGGAGTACCAACCGAGAAGGAAGCAATTCCGAACCTCACCTTGCGAGGCTTTGGCACGATCGAC
CGTGTGAAGGCGAAGCTGGAGCGGGCCTGCCCTGGAGTGGTGTCCTGTGCTGATATCTTGGCTCTGGTAGCAAGGGACGTTGTTGTACTG
ACCAAAGGGCCTCATTGGGATGTTCCAACC
GGGCGGAGAGACGGAAGAATATCAGTGAAGCAAGATGCTCTGAACAACCTCCCTGCGCCCTTCTTTGATGCTGGTCGGAACCTGTTCCAGTTCTTCATCCCCAAGGGCCTCGATGCCAAG
GATCAGATTGTTCTGCTAG
GAGGGCACACTCTGGGTACCTCGCACTGCTCGTCGTTCGCGGACCGGCTGTACAACTTCAGCGGCACGATGACGGCGGACCCGTCGCTGGACAAGCGGTAC
CTGCCGCGGCTGAAGAGCAAATGCAGCAACCCCGGCGACACGACGACGCTGGTGGAGATGGACCCCGGCAGCTTCCGCACGTTCGACGCGAGCTACTACCGGCACGTCGCCAGAGGCCGG
TCGCTCTTCTTCTCCGACCAGACGCTCATGAACGACGCCTTCGCCAGGGCCTACGTCCAGCGCCAGGCCGCCGTGGCCGACGCCGGCGCCTACCCCGCCGAGTTCTTCGCCGACTTCGCC
GCGTCCATGGTCAAGATGGGCGGCGTGCAGGTGCTCACCGGCGCGCAGGGGGAGGTCCGGAGGCACTGCGCCCTCGTCAACTAG

Retrieve as FASTA